Recombinant Human ROD1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ROD1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 16-114 of Human ROD1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PTBP3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ROD1 Protein

  • DKFZp781I1117
  • fission yeast differentiation regulator
  • PTBP3
  • regulator of differentiation (in S. pombe) 1
  • regulator of differentiation 1
  • ROD1 regulator of differentiation 1 (S. pombe)
  • Rod1

Background

ROD1 - ROD1 regulator of differentiation 1 (S. pombe)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89614
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2390
Species: Hu
Applications: WB, Simple Western
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB600-270
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NBP2-19473
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ROD1 Partial Recombinant Protein (H00009991-Q01) (0)

There are no publications for ROD1 Partial Recombinant Protein (H00009991-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROD1 Partial Recombinant Protein (H00009991-Q01) (0)

There are no reviews for ROD1 Partial Recombinant Protein (H00009991-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ROD1 Partial Recombinant Protein (H00009991-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ROD1 Products

Bioinformatics Tool for ROD1 Partial Recombinant Protein (H00009991-Q01)

Discover related pathways, diseases and genes to ROD1 Partial Recombinant Protein (H00009991-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROD1 Partial Recombinant Protein (H00009991-Q01)

Discover more about diseases related to ROD1 Partial Recombinant Protein (H00009991-Q01).
 

Pathways for ROD1 Partial Recombinant Protein (H00009991-Q01)

View related products by pathway.

PTMs for ROD1 Partial Recombinant Protein (H00009991-Q01)

Learn more about PTMs related to ROD1 Partial Recombinant Protein (H00009991-Q01).

Blogs on ROD1

There are no specific blogs for ROD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ROD1 Antibody (4C9)
H00009991-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ROD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTBP3