Recombinant Human ROCK1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related ROCK1 Peptides and Proteins

Order Details


    • Catalog Number
      H00006093-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ROCK1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 401-510 of Human ROCK1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SNRRYLSSANPNDNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRR

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
ROCK1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ROCK1 Protein

  • EC 2.7.11
  • EC 2.7.11.1
  • MGC131603
  • MGC43611
  • p160 ROCK-1
  • p160ROCK
  • p160-ROCK
  • PRO0435
  • Renal carcinoma antigen NY-REN-35
  • Rho kinase
  • rho-associated protein kinase 1
  • Rho-associated, coiled-coil containing protein kinase 1
  • Rho-associated, coiled-coil-containing protein kinase 1
  • ROCK1
  • ROK beta

Background

ROCK1 - Rho-associated, coiled-coil containing protein kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20199
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB110-38889
Species: Hu
Applications: WB, IP
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for ROCK1 Partial Recombinant Protein (H00006093-Q01) (0)

There are no publications for ROCK1 Partial Recombinant Protein (H00006093-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROCK1 Partial Recombinant Protein (H00006093-Q01) (0)

There are no reviews for ROCK1 Partial Recombinant Protein (H00006093-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ROCK1 Partial Recombinant Protein (H00006093-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ROCK1 Products

Bioinformatics Tool for ROCK1 Partial Recombinant Protein (H00006093-Q01)

Discover related pathways, diseases and genes to ROCK1 Partial Recombinant Protein (H00006093-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROCK1 Partial Recombinant Protein (H00006093-Q01)

Discover more about diseases related to ROCK1 Partial Recombinant Protein (H00006093-Q01).
 

Pathways for ROCK1 Partial Recombinant Protein (H00006093-Q01)

View related products by pathway.

PTMs for ROCK1 Partial Recombinant Protein (H00006093-Q01)

Learn more about PTMs related to ROCK1 Partial Recombinant Protein (H00006093-Q01).
 

Research Areas for ROCK1 Partial Recombinant Protein (H00006093-Q01)

Find related products by research area.

Blogs on ROCK1.

A good helper on validating your FLOW and IHC data - Rabbit IgG Isotype Control
Isotype controls are primarily used as negative controls in flow cytometry but they can also be used for immunohistochemistry. They are used to approximate the non-specific target primary antibody binding due to protein-protein interactions, binding t...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ROCK1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ROCK1
Entrez