ROBO3 Antibody

Images

 
Immunohistochemistry: ROBO3 Antibody [NBP1-83626] - Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Product Discontinued
View other related ROBO3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83626
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ROBO3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EGPVYSTIDPAGEELQTFHGGFPQHPSGDLGPWSQYAPPEWSQGDSGAKGGKVKLLGKPVQMPSLNWPEALPPPPPSCELSCLEGPEEELEGSSEPEEWCPPMPERSHLTE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ROBO3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
Human Brain Corpus Callosum Whole Tissue Lysate (Adult Whole Parkinson's)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ROBO3 Antibody

  • FLJ21044
  • HGPPS
  • HGPS
  • RBIG1horizontal gaze palsy with progressive scoliosis
  • retinoblastoma inhibiting gene 1
  • RIG1
  • ROBO3
  • roundabout (axon guidance receptor, Drosophila) homolog 3
  • roundabout homolog 3
  • roundabout, axon guidance receptor, homolog 3 (Drosophila)
  • Roundabout-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56649
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP2-45678
Species: Hu
Applications: WB, IHC, IF
NBP1-81399
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-13350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-1244
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1749
Species: Rt
Applications: WB, IHC
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, BA, B/N, Flow-IC
NB100-80859
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87076
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6139
Species: Hu
Applications: ICC
NB100-2387
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
NB110-58780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67741
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83626
Species: Hu
Applications: IHC, IHC-P

Publications for ROBO3 Antibody (NBP1-83626) (0)

There are no publications for ROBO3 Antibody (NBP1-83626).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROBO3 Antibody (NBP1-83626) (0)

There are no reviews for ROBO3 Antibody (NBP1-83626). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ROBO3 Antibody (NBP1-83626) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ROBO3 Products

Bioinformatics Tool for ROBO3 Antibody (NBP1-83626)

Discover related pathways, diseases and genes to ROBO3 Antibody (NBP1-83626). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROBO3 Antibody (NBP1-83626)

Discover more about diseases related to ROBO3 Antibody (NBP1-83626).
 

Pathways for ROBO3 Antibody (NBP1-83626)

View related products by pathway.

PTMs for ROBO3 Antibody (NBP1-83626)

Learn more about PTMs related to ROBO3 Antibody (NBP1-83626).
 

Research Areas for ROBO3 Antibody (NBP1-83626)

Find related products by research area.

Blogs on ROBO3

There are no specific blogs for ROBO3, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROBO3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ROBO3