Recombinant Human ROBO1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related ROBO1 Peptides and Proteins

Order Details


    • Catalog Number
      H00006091-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ROBO1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 491-589 of Human ROBO1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ROBO1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ROBO1 Protein

  • DUTT1
  • DUTT1Drosophila) homolog 1
  • H-Robo-1
  • MGC131599
  • MGC133277
  • ROBO1
  • roundabout, axon guidance receptor, homolog 1 (Drosophila)

Background

Bilateral symmetric nervous systems have special midline structures that establish a partition between the two mirror image halves. Some axons project toward and across the midline in response to long-range chemoattractants emanating from the midline. In Drosophila, the roundabout gene, a member of the immunoglobulin gene superfamily, encodes an integral membrane protein that is both an axon guidance receptor and a cell adhesion receptor. This receptor is involved in the decision by axons to cross the central nervous system midline. The protein encoded by this gene is structurally similar to the Drosophila roundabout protein. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3629
Species: Hu, Mu, Rt
Applications: WB, Neut
NBP2-20398
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
6514-SL
Species: Hu
AF3147
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-58778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3155
Species: Mu
Applications: WB, IHC
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2806
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-93472
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
AF844
Species: Mu
Applications: WB, Block
AF756
Species: Mu
Applications: WB, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1166
Species: Mu
Applications: WB
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP1-87076
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
H00006091-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ROBO1 Partial Recombinant Protein (H00006091-Q01) (0)

There are no publications for ROBO1 Partial Recombinant Protein (H00006091-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROBO1 Partial Recombinant Protein (H00006091-Q01) (0)

There are no reviews for ROBO1 Partial Recombinant Protein (H00006091-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ROBO1 Partial Recombinant Protein (H00006091-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ROBO1 Products

Bioinformatics Tool for ROBO1 Partial Recombinant Protein (H00006091-Q01)

Discover related pathways, diseases and genes to ROBO1 Partial Recombinant Protein (H00006091-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROBO1 Partial Recombinant Protein (H00006091-Q01)

Discover more about diseases related to ROBO1 Partial Recombinant Protein (H00006091-Q01).
 

Pathways for ROBO1 Partial Recombinant Protein (H00006091-Q01)

View related products by pathway.

PTMs for ROBO1 Partial Recombinant Protein (H00006091-Q01)

Learn more about PTMs related to ROBO1 Partial Recombinant Protein (H00006091-Q01).
 

Research Areas for ROBO1 Partial Recombinant Protein (H00006091-Q01)

Find related products by research area.

Blogs on ROBO1

There are no specific blogs for ROBO1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ROBO1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ROBO1
Entrez