Recombinant Human RNF212 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RNF212 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 133 - 232 of Human RNF212 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IKSSVSTKPHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAAGPARISMISPPQDGRMAPCARRVCHFQRFTMFLHRRLSSLAAPPSVQFWKARGTHQL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RNF212

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF212 Protein

  • FLJ38841
  • FLJ42587
  • hypothetical protein LOC285498
  • MGC120227
  • MGC120228
  • ring finger protein 212
  • ZHP3

Background

LOC285498 - hypothetical protein LOC285498

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80118
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03897
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90941
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-149
Species: Hu, Mu, Bv, Rt(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
29470002
Species: Ce
Applications: ELISA, ICC/IF, IHC
H00007357-M03
Species: Hu
Applications: WB, ELISA

Publications for RNF212 Partial Recombinant Protein (H00285498-Q01) (0)

There are no publications for RNF212 Partial Recombinant Protein (H00285498-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF212 Partial Recombinant Protein (H00285498-Q01) (0)

There are no reviews for RNF212 Partial Recombinant Protein (H00285498-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF212 Partial Recombinant Protein (H00285498-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF212 Products

Bioinformatics Tool for RNF212 Partial Recombinant Protein (H00285498-Q01)

Discover related pathways, diseases and genes to RNF212 Partial Recombinant Protein (H00285498-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF212 Partial Recombinant Protein (H00285498-Q01)

Discover more about diseases related to RNF212 Partial Recombinant Protein (H00285498-Q01).
 

Pathways for RNF212 Partial Recombinant Protein (H00285498-Q01)

View related products by pathway.

Blogs on RNF212

There are no specific blogs for RNF212, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PDZK1 Antibody
NB400-149
RNF212 Antibody (5H3)
H00285498-M01
REC8 Antibody
29470002-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF212 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF212