RNF2 Antibody (2F7)


Western Blot: RNF2 Antibody (2F7) [H00006045-M13] - Analysis of RNF2 expression in HepG2 (Cat # L019V1).

Product Details

Product Discontinued
View other related RNF2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RNF2 Antibody (2F7) Summary

RNF2 (NP_009143 164 a.a. - 223 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDG
RNF2 - ring finger protein 2 (2F7)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Positive Control
RNF2 Lysate (NBP2-64723)

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF2 Antibody (2F7)

  • BAP-1
  • BAP1RING finger protein 1B
  • DING
  • DINGRING finger protein BAP-1
  • EC 6.3.2
  • HIPI3
  • HIPI3RING1BE3 ubiquitin-protein ligase RING2
  • Huntingtin-interacting protein 2-interacting protein 3
  • Protein DinG
  • ring finger protein 2HIP2-interacting protein 3
  • RING1B
  • RING2
  • RING2EC 6.3.2.-
  • RNF2


Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA

Publications for RNF2 Antibody (H00006045-M13) (0)

There are no publications for RNF2 Antibody (H00006045-M13).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF2 Antibody (H00006045-M13) (0)

There are no reviews for RNF2 Antibody (H00006045-M13). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF2 Antibody (H00006045-M13) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional RNF2 Products

Bioinformatics Tool for RNF2 Antibody (H00006045-M13)

Discover related pathways, diseases and genes to RNF2 Antibody (H00006045-M13). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF2 Antibody (H00006045-M13)

Discover more about diseases related to RNF2 Antibody (H00006045-M13).

Pathways for RNF2 Antibody (H00006045-M13)

View related products by pathway.

PTMs for RNF2 Antibody (H00006045-M13)

Learn more about PTMs related to RNF2 Antibody (H00006045-M13).

Research Areas for RNF2 Antibody (H00006045-M13)

Find related products by research area.

Blogs on RNF2

There are no specific blogs for RNF2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RNF2 Antibody (2F7) and receive a gift card or discount.


Gene Symbol RNF2