Recombinant Human RNF170 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RNF170 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 121-193 of Human RNF170 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RNF170

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF170 Protein

  • DKFZP564A022
  • FLJ38306
  • Putative LAG1-interacting protein
  • ring finger protein 170

Background

RNF170 - ring finger protein 170

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88539
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83639
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90660
Species: Hu
Applications: IHC, IHC-P

Publications for RNF170 Partial Recombinant Protein (H00081790-Q01) (0)

There are no publications for RNF170 Partial Recombinant Protein (H00081790-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF170 Partial Recombinant Protein (H00081790-Q01) (0)

There are no reviews for RNF170 Partial Recombinant Protein (H00081790-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF170 Partial Recombinant Protein (H00081790-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF170 Products

Bioinformatics Tool for RNF170 Partial Recombinant Protein (H00081790-Q01)

Discover related pathways, diseases and genes to RNF170 Partial Recombinant Protein (H00081790-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF170 Partial Recombinant Protein (H00081790-Q01)

Discover more about diseases related to RNF170 Partial Recombinant Protein (H00081790-Q01).
 

Pathways for RNF170 Partial Recombinant Protein (H00081790-Q01)

View related products by pathway.

PTMs for RNF170 Partial Recombinant Protein (H00081790-Q01)

Learn more about PTMs related to RNF170 Partial Recombinant Protein (H00081790-Q01).
 

Research Areas for RNF170 Partial Recombinant Protein (H00081790-Q01)

Find related products by research area.

Blogs on RNF170

There are no specific blogs for RNF170, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SPFH2 Antibody
NBP1-88247
RNF170 Antibody
NBP2-48986
ERLIN1 Antibody
NBP1-88539

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF170 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF170