Recombinant Human RNF17 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RNF17 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 30-139 of Human RNF17

Source: Wheat Germ

Amino Acid Sequence: IQCTRCGRRVSRSSGHHCELQCGHAFCELCLLMTEECTTIICPDCEVATAVNTRQRYYPMAGYIKEDSIMEKLQPKTIKNCSQDFKKTADQLTTGLERSASTDKTLLNSS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RNF17
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF17 Protein

  • FLJ11045
  • Mmip-2
  • ring finger protein 17
  • SPATA23
  • spermatogenesis associated 23
  • TDRD4
  • tudor domain containing 4
  • Tudor domain-containing protein 4

Background

RNF17 - ring finger protein 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF6548
Species: Hu, Mu
Applications: IHC
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF6296
Species: Hu
Applications: WB
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
AF6286
Species: Hu
Applications: WB, IHC
NBP2-24590
Species: Mu
Applications: WB, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4304
Species: Hu
Applications: WB
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
38150002
Species: Hu
Applications: WB, ELISA
NBP2-55609
Species: Hu
Applications: WB, ICC/IF
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC, IF
NBP1-81971
Species: Hu
Applications: IHC, IHC-P
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-137
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
AF4185
Species: Hu
Applications: ICC

Publications for RNF17 Partial Recombinant Protein (H00056163-Q01) (0)

There are no publications for RNF17 Partial Recombinant Protein (H00056163-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF17 Partial Recombinant Protein (H00056163-Q01) (0)

There are no reviews for RNF17 Partial Recombinant Protein (H00056163-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF17 Partial Recombinant Protein (H00056163-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for RNF17 Partial Recombinant Protein (H00056163-Q01)

Discover related pathways, diseases and genes to RNF17 Partial Recombinant Protein (H00056163-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RNF17 Partial Recombinant Protein (H00056163-Q01)

View related products by pathway.

PTMs for RNF17 Partial Recombinant Protein (H00056163-Q01)

Learn more about PTMs related to RNF17 Partial Recombinant Protein (H00056163-Q01).

Blogs on RNF17

There are no specific blogs for RNF17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RNF17 Antibody
NBP1-83782
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF17 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF17