Recombinant Human RNF125 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RNF125 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 143-231 of Human RNF125 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RNF125
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF125 Protein

  • E3 ubiquitin-protein ligase RNF125
  • EC 6.3.2.-
  • FLJ20456
  • MGC21737
  • ring finger protein 125TRAC1
  • T-cell RING activation protein 1
  • T-cell ring protein identified in activation screen
  • TRAC-1

Background

RNF125 - ring finger protein 125

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87204
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-04351
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81212
Species: Hu
Applications: WB, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00054941-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RNF125 Partial Recombinant Protein (H00054941-Q01) (0)

There are no publications for RNF125 Partial Recombinant Protein (H00054941-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF125 Partial Recombinant Protein (H00054941-Q01) (0)

There are no reviews for RNF125 Partial Recombinant Protein (H00054941-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF125 Partial Recombinant Protein (H00054941-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF125 Products

Bioinformatics Tool for RNF125 Partial Recombinant Protein (H00054941-Q01)

Discover related pathways, diseases and genes to RNF125 Partial Recombinant Protein (H00054941-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF125 Partial Recombinant Protein (H00054941-Q01)

Discover more about diseases related to RNF125 Partial Recombinant Protein (H00054941-Q01).
 

Pathways for RNF125 Partial Recombinant Protein (H00054941-Q01)

View related products by pathway.

PTMs for RNF125 Partial Recombinant Protein (H00054941-Q01)

Learn more about PTMs related to RNF125 Partial Recombinant Protein (H00054941-Q01).
 

Research Areas for RNF125 Partial Recombinant Protein (H00054941-Q01)

Find related products by research area.

Blogs on RNF125

There are no specific blogs for RNF125, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RNF125 Antibody
NBP1-83653

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF125 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF125