RNF11 Antibody


Western Blot: RNF11 Antibody [NBP2-13235] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunohistochemistry-Paraffin: RNF11 Antibody [NBP2-13235] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

RNF11 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHP TPSQTRLATQLTEEEQIRIAQRIGLIQ
Specificity of human, mouse, rat RNF11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RNF11 Protein (NBP2-13235PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RNF11 Antibody

  • CGI-123
  • MGC51169
  • ring finger protein 11
  • RNF11
  • SID1669
  • Sid1669p


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RNF11 Antibody (NBP2-13235) (0)

There are no publications for RNF11 Antibody (NBP2-13235).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF11 Antibody (NBP2-13235) (0)

There are no reviews for RNF11 Antibody (NBP2-13235). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF11 Antibody (NBP2-13235) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RNF11 Products

Bioinformatics Tool for RNF11 Antibody (NBP2-13235)

Discover related pathways, diseases and genes to RNF11 Antibody (NBP2-13235). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF11 Antibody (NBP2-13235)

Discover more about diseases related to RNF11 Antibody (NBP2-13235).

Pathways for RNF11 Antibody (NBP2-13235)

View related products by pathway.

PTMs for RNF11 Antibody (NBP2-13235)

Learn more about PTMs related to RNF11 Antibody (NBP2-13235).

Research Areas for RNF11 Antibody (NBP2-13235)

Find related products by research area.

Blogs on RNF11

There are no specific blogs for RNF11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RNF11 Antibody and receive a gift card or discount.


Gene Symbol RNF11