RNASE9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RNASE9 Antibody [NBP1-83303] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: RNASE9 Antibody [NBP1-83303] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Product Discontinued
View other related RNASE9 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83303
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RNASE9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNHEIMGKNVYYKHRWVAEHYFLLMQYDELQKICYNRFVPCKNGIRKCNRSKGLVEGVYCNLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNASE9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNASE9 Antibody

  • h461
  • HEL128
  • ribonuclear enzyme
  • ribonuclease 9
  • ribonuclease, RNase A family, 9 (non-active)
  • ribonuclease-like protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30865
Species: Hu
Applications: IHC, IHC-P
NBP1-57957
Species: Hu
Applications: WB
MAB3694
Species: Hu
Applications: WB, IHC
NB100-56630
Species: Hu
Applications: WB
MAB333
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for RNASE9 Antibody (NBP1-83303) (0)

There are no publications for RNASE9 Antibody (NBP1-83303).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNASE9 Antibody (NBP1-83303) (0)

There are no reviews for RNASE9 Antibody (NBP1-83303). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RNASE9 Antibody (NBP1-83303) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNASE9 Products

Bioinformatics Tool for RNASE9 Antibody (NBP1-83303)

Discover related pathways, diseases and genes to RNASE9 Antibody (NBP1-83303). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNASE9 Antibody (NBP1-83303)

Discover more about diseases related to RNASE9 Antibody (NBP1-83303).
 

Pathways for RNASE9 Antibody (NBP1-83303)

View related products by pathway.

Blogs on RNASE9

There are no specific blogs for RNASE9, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNASE9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASE9