RNase L Antibody (3B4)

Images

 
Sandwich ELISA: RNase L Antibody (3B4) [H00006041-M01] - Detection limit for recombinant GST tagged RNASEL is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RNase L Antibody (3B4) Summary

Immunogen
RNASEL (NP_066956 619 a.a. - 728 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCD
Specificity
RNASEL - ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RNASEL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNase L Antibody (3B4)

  • 2-5A-dependent ribonuclease
  • 2-5A-dependent RNase
  • 2'-5'-oligoisoadenylate synthetase-dependent
  • EC 3.1.26.-
  • HPC1
  • interferon-induced 2-5A-dependent RNase
  • MGC104972
  • MGC133329
  • PRCA1
  • prostate cancer 1
  • Ribonuclease 4
  • ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent)
  • Ribonuclease L
  • RNase L
  • RNS4DKFZp781D08126

Background

This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candidate for the hereditary prostate cancer 1 (HPC1) allele.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
AF5550
Species: Mu, Rt
Applications: WB
NB400-116
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-00092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-Fr, PLA
NBP1-84620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
AF4715
Species: Mu
Applications: WB
NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP1-83122
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for RNase L Antibody (H00006041-M01) (0)

There are no publications for RNase L Antibody (H00006041-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNase L Antibody (H00006041-M01) (0)

There are no reviews for RNase L Antibody (H00006041-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RNase L Antibody (H00006041-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNase L Products

Bioinformatics Tool for RNase L Antibody (H00006041-M01)

Discover related pathways, diseases and genes to RNase L Antibody (H00006041-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNase L Antibody (H00006041-M01)

Discover more about diseases related to RNase L Antibody (H00006041-M01).
 

Pathways for RNase L Antibody (H00006041-M01)

View related products by pathway.

PTMs for RNase L Antibody (H00006041-M01)

Learn more about PTMs related to RNase L Antibody (H00006041-M01).
 

Research Areas for RNase L Antibody (H00006041-M01)

Find related products by research area.

Blogs on RNase L

There are no specific blogs for RNase L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNase L Antibody (3B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASEL
Entrez
Uniprot