RNA polymerase I termination factor Antibody

Images

 
Western Blot: RNA polymerase I termination factor Antibody [NBP1-74129] - Human Fetal Liver Lysate, Antibody Titration: 1 ug/ml, and Gel concentration: 6-18%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNA polymerase I termination factor Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of TTF1. Immunizing peptide sequence KNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPAN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TTF1 and was validated on Western blot.
Theoretical MW
103 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RNA polymerase I termination factor Antibody

  • RNA polymerase I termination factor
  • transcription termination factor 1
  • Transcription termination factor I
  • transcription termination factor, RNA polymerase I
  • TTF-1
  • TTF-I

Background

This gene encodes a transcription termination factor that is localized to the nucleolus and plays a critical role in ribosomal gene transcription. The encoded protein mediates the termination of RNA polymerase I transcription by binding to Sal box terminator elements downstream of pre-rRNA coding regions. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. This gene shares the symbol/alias 'TFF1' with another gene, NK2 homeobox 1, also known as thyroid transcription factor 1, which plays a role in the regulation of thyroid-specific gene expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-85599
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85571
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-33982
Species: Hu
Applications: IHC, IHC-P
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP1-80670
Species: Hu
Applications: IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IF
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-32440
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP, Single Cell Western
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB300-653
Species: Hu, Mu, Rt, Ch, Fe, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RNA polymerase I termination factor Antibody (NBP1-74129) (0)

There are no publications for RNA polymerase I termination factor Antibody (NBP1-74129).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNA polymerase I termination factor Antibody (NBP1-74129) (0)

There are no reviews for RNA polymerase I termination factor Antibody (NBP1-74129). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNA polymerase I termination factor Antibody (NBP1-74129) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNA polymerase I termination factor Products

Bioinformatics Tool for RNA polymerase I termination factor Antibody (NBP1-74129)

Discover related pathways, diseases and genes to RNA polymerase I termination factor Antibody (NBP1-74129). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNA polymerase I termination factor Antibody (NBP1-74129)

Discover more about diseases related to RNA polymerase I termination factor Antibody (NBP1-74129).
 

Pathways for RNA polymerase I termination factor Antibody (NBP1-74129)

View related products by pathway.

PTMs for RNA polymerase I termination factor Antibody (NBP1-74129)

Learn more about PTMs related to RNA polymerase I termination factor Antibody (NBP1-74129).

Blogs on RNA polymerase I termination factor

There are no specific blogs for RNA polymerase I termination factor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNA polymerase I termination factor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTF1
Uniprot