RNA Helicase A Antibody (3G7) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related RNA Helicase A Primary Antibodies

Order Details


    • Catalog Number
      H00001660-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RNA Helicase A Antibody (3G7) [PerCP] Summary

Immunogen
DHX9 (NP_001348, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
Specificity
DHX9 - DEAH (Asp-Glu-Ala-His) box polypeptide 9
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DHX9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNA Helicase A Antibody (3G7) [PerCP]

  • DDX9ATP-dependent RNA helicase A
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNAhelicase II; leukophysin)
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9
  • DEAH (Asp-Glu-Ala-His) box polypeptide 9
  • DEAH box protein 9
  • EC 3.6.1
  • EC 3.6.1.15
  • EC 3.6.4.13
  • FLJ17406
  • leukophysin
  • LKP
  • NDH II
  • NDH2
  • NDHII
  • Nuclear DNA helicase II
  • RHA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
AF3757
Species: Hu
Applications: WB, ICC
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84056
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RNA Helicase A Antibody (H00001660-M01PCP) (0)

There are no publications for RNA Helicase A Antibody (H00001660-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNA Helicase A Antibody (H00001660-M01PCP) (0)

There are no reviews for RNA Helicase A Antibody (H00001660-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNA Helicase A Antibody (H00001660-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNA Helicase A Products

Bioinformatics Tool for RNA Helicase A Antibody (H00001660-M01PCP)

Discover related pathways, diseases and genes to RNA Helicase A Antibody (H00001660-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNA Helicase A Antibody (H00001660-M01PCP)

Discover more about diseases related to RNA Helicase A Antibody (H00001660-M01PCP).
 

Pathways for RNA Helicase A Antibody (H00001660-M01PCP)

View related products by pathway.

PTMs for RNA Helicase A Antibody (H00001660-M01PCP)

Learn more about PTMs related to RNA Helicase A Antibody (H00001660-M01PCP).
 

Research Areas for RNA Helicase A Antibody (H00001660-M01PCP)

Find related products by research area.

Blogs on RNA Helicase A

There are no specific blogs for RNA Helicase A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNA Helicase A Antibody (3G7) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX9