RNA Helicase A Antibody (3G7) [DyLight 755]

Images

 

Product Details

Summary
Product Discontinued
View other related RNA Helicase A Primary Antibodies

Order Details


    • Catalog Number
      H00001660-M01IR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RNA Helicase A Antibody (3G7) [DyLight 755] Summary

Immunogen
DHX9 (NP_001348, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
Specificity
DHX9 - DEAH (Asp-Glu-Ala-His) box polypeptide 9
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DHX9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 755
Format
DyLight 755 (A=754, E=776)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Reactivity Notes

Human and African Green Monkey Cell lysate.

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNA Helicase A Antibody (3G7) [DyLight 755]

  • DDX9ATP-dependent RNA helicase A
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNAhelicase II; leukophysin)
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9
  • DEAH (Asp-Glu-Ala-His) box polypeptide 9
  • DEAH box protein 9
  • EC 3.6.1
  • EC 3.6.1.15
  • EC 3.6.4.13
  • FLJ17406
  • leukophysin
  • LKP
  • NDH II
  • NDH2
  • NDHII
  • Nuclear DNA helicase II
  • RHA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-49537
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14319
Species: Hu
Applications: IHC, IHC-P
AF3846
Species: Hu, Mu, Rt
Applications: WB, IHC
H00027161-M01
Species: Hu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NBP1-69571
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84056
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-41185
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22128
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB5285
Species: Hu
Applications: WB, Simple Western
NB200-351
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RNA Helicase A Antibody (H00001660-M01IR) (0)

There are no publications for RNA Helicase A Antibody (H00001660-M01IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNA Helicase A Antibody (H00001660-M01IR) (0)

There are no reviews for RNA Helicase A Antibody (H00001660-M01IR). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNA Helicase A Antibody (H00001660-M01IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNA Helicase A Products

Related Products by Gene

Bioinformatics Tool for RNA Helicase A Antibody (H00001660-M01IR)

Discover related pathways, diseases and genes to RNA Helicase A Antibody (H00001660-M01IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNA Helicase A Antibody (H00001660-M01IR)

Discover more about diseases related to RNA Helicase A Antibody (H00001660-M01IR).
 

Pathways for RNA Helicase A Antibody (H00001660-M01IR)

View related products by pathway.

PTMs for RNA Helicase A Antibody (H00001660-M01IR)

Learn more about PTMs related to RNA Helicase A Antibody (H00001660-M01IR).
 

Research Areas for RNA Helicase A Antibody (H00001660-M01IR)

Find related products by research area.

Blogs on RNA Helicase A

There are no specific blogs for RNA Helicase A, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol DHX9

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00001660-M01IR below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.