RKIP/PBP Antibody


Western Blot: RKIP/PBP Antibody [NBP1-52938] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.

Product Details

Product Discontinued
View other related RKIP/PBP Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RKIP/PBP Antibody Summary

Synthetic peptides corresponding to PEBP1(phosphatidylethanolamine binding protein 1) The peptide sequence was selected from the C terminal of PEBP1. Peptide sequence LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PEBP1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RKIP/PBP Antibody

  • HCNP
  • HCNPpp
  • hippocampal cholinergic neurostimulating peptide
  • Neuropolypeptide h3
  • PBP
  • PEBP1
  • PEBP-1
  • phosphatidylethanolamine binding protein 1
  • phosphatidylethanolamine-binding protein 1
  • prostatic binding protein
  • Prostatic-binding protein
  • Raf kinase inhibitory protein
  • RKIP
  • RKIPRaf kinase inhibitor protein


PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for RKIP/PBP Antibody (NBP1-52938) (0)

There are no publications for RKIP/PBP Antibody (NBP1-52938).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RKIP/PBP Antibody (NBP1-52938) (0)

There are no reviews for RKIP/PBP Antibody (NBP1-52938). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RKIP/PBP Antibody (NBP1-52938) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RKIP/PBP Products

Bioinformatics Tool for RKIP/PBP Antibody (NBP1-52938)

Discover related pathways, diseases and genes to RKIP/PBP Antibody (NBP1-52938). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RKIP/PBP Antibody (NBP1-52938)

Discover more about diseases related to RKIP/PBP Antibody (NBP1-52938).

Pathways for RKIP/PBP Antibody (NBP1-52938)

View related products by pathway.

PTMs for RKIP/PBP Antibody (NBP1-52938)

Learn more about PTMs related to RKIP/PBP Antibody (NBP1-52938).

Research Areas for RKIP/PBP Antibody (NBP1-52938)

Find related products by research area.

Blogs on RKIP/PBP

There are no specific blogs for RKIP/PBP, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RKIP/PBP Antibody and receive a gift card or discount.


Gene Symbol PEBP1