RIPK4 Antibody

Images

 
Immunohistochemistry-Paraffin: RIPK4 Antibody [NBP1-89083] - Staining of human pancreas shows strong positivity in subsets of cells.
Immunofluorescence: RIPK4 Antibody [NBP1-89083] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli.

Product Details

Summary
Product Discontinued
View other related RIPK4 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-89083
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RIPK4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQEITSETEDLCEKPDDEVKETAHDLDVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIPK4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIPK4 Antibody

  • ANKK2
  • ANKRD3MGC129993
  • ankyrin repeat domain 3
  • Ankyrin repeat domain-containing protein 3
  • DIKMGC129992
  • EC 2.7.11
  • EC 2.7.11.1
  • PKC-delta-interacting protein kinase
  • PKK
  • receptor-interacting serine/threonine-protein kinase 4
  • receptor-interacting serine-threonine kinase 4
  • RIP4
  • serine/threonine-protein kinase ANKRD3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NBP2-24756
Species: Hu
Applications: WB, IHC-P
MAB6095
Species: Hu
Applications: WB
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-89083
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RIPK4 Antibody (NBP1-89083) (0)

There are no publications for RIPK4 Antibody (NBP1-89083).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIPK4 Antibody (NBP1-89083) (0)

There are no reviews for RIPK4 Antibody (NBP1-89083). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RIPK4 Antibody (NBP1-89083) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIPK4 Products

Bioinformatics Tool for RIPK4 Antibody (NBP1-89083)

Discover related pathways, diseases and genes to RIPK4 Antibody (NBP1-89083). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIPK4 Antibody (NBP1-89083)

Discover more about diseases related to RIPK4 Antibody (NBP1-89083).
 

Pathways for RIPK4 Antibody (NBP1-89083)

View related products by pathway.

PTMs for RIPK4 Antibody (NBP1-89083)

Learn more about PTMs related to RIPK4 Antibody (NBP1-89083).
 

Research Areas for RIPK4 Antibody (NBP1-89083)

Find related products by research area.

Blogs on RIPK4

There are no specific blogs for RIPK4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIPK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RIPK4