Ring finger protein 138 Antibody

Images

 
Western Blot: Ring finger protein 138 Antibody [NBP1-86986] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Ring finger protein 138 Antibody [NBP1-86986] - Staining of human placenta shows strong cytoplasmic positivity in cytotrophoblasts.

Product Details

Summary
Product Discontinued
View other related Ring finger protein 138 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-86986
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Ring finger protein 138 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEFVNLQLDEETQYQTAVEES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF138
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ring finger protein 138 Antibody

  • E3 ubiquitin-protein ligase RNF138
  • EC 6.3.2.-
  • hNARF
  • HSD-4
  • MGC8758
  • NARF
  • Nemo-like kinase-associated RING finger protein
  • ring finger protein 138NLK-associated RING finger protein
  • STRIN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1218
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP, PEP-ELISA
NBP2-35213
Species: Hu
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00056127-R01
Species: Hu
NBP1-83653
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54805
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00051701-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, PLA
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-86986
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Ring finger protein 138 Antibody (NBP1-86986) (0)

There are no publications for Ring finger protein 138 Antibody (NBP1-86986).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ring finger protein 138 Antibody (NBP1-86986) (0)

There are no reviews for Ring finger protein 138 Antibody (NBP1-86986). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ring finger protein 138 Antibody (NBP1-86986) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ring finger protein 138 Products

Bioinformatics Tool for Ring finger protein 138 Antibody (NBP1-86986)

Discover related pathways, diseases and genes to Ring finger protein 138 Antibody (NBP1-86986). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ring finger protein 138 Antibody (NBP1-86986)

Discover more about diseases related to Ring finger protein 138 Antibody (NBP1-86986).
 

Pathways for Ring finger protein 138 Antibody (NBP1-86986)

View related products by pathway.

PTMs for Ring finger protein 138 Antibody (NBP1-86986)

Learn more about PTMs related to Ring finger protein 138 Antibody (NBP1-86986).
 

Research Areas for Ring finger protein 138 Antibody (NBP1-86986)

Find related products by research area.

Blogs on Ring finger protein 138

There are no specific blogs for Ring finger protein 138, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ring finger protein 138 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF138