Ribophorin II Antibody


Western Blot: Ribophorin II Antibody [NBP1-59935] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related Ribophorin II Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Ribophorin II Antibody Summary

Synthetic peptides corresponding to RPN2(ribophorin II) The peptide sequence was selected from the middle region of RPN2. Peptide sequence IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP.
This product is specific to Subunit or Isoform: 2.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RPN2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ribophorin II Antibody

  • ribophorin IIDolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit
  • ribophorin-2
  • RPN-IIdolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
  • SWP1


RPN2 is a type I integral membrane protein found only in the rough endoplasmic reticulum. The protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus m


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IHC-FrFl
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for Ribophorin II Antibody (NBP1-59935) (0)

There are no publications for Ribophorin II Antibody (NBP1-59935).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ribophorin II Antibody (NBP1-59935) (0)

There are no reviews for Ribophorin II Antibody (NBP1-59935). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ribophorin II Antibody (NBP1-59935) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Ribophorin II Products

Bioinformatics Tool for Ribophorin II Antibody (NBP1-59935)

Discover related pathways, diseases and genes to Ribophorin II Antibody (NBP1-59935). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ribophorin II Antibody (NBP1-59935)

Discover more about diseases related to Ribophorin II Antibody (NBP1-59935).

Pathways for Ribophorin II Antibody (NBP1-59935)

View related products by pathway.

PTMs for Ribophorin II Antibody (NBP1-59935)

Learn more about PTMs related to Ribophorin II Antibody (NBP1-59935).

Blogs on Ribophorin II

There are no specific blogs for Ribophorin II, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ribophorin II Antibody and receive a gift card or discount.


Gene Symbol RPN2