Ribophorin I Antibody


Western Blot: ribophorin I Antibody [NBP1-69258] - This Anti-RPN1 antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related Ribophorin I Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Ribophorin I Antibody Summary

Synthetic peptides corresponding to RPN1(ribophorin I) The peptide sequence was selected from the middle region of RPN1. Peptide sequence AAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKK.
This product is specific to Subunit or Isoform: 1.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RPN1 and was validated on Western blot.
Theoretical MW
66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ribophorin I Antibody

  • DKFZp686B16177
  • dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit
  • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit
  • dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
  • EC
  • oligosaccharyltransferase 1 homolog
  • OST1
  • ribophorin IRBPH1
  • ribophorin-1
  • RPN-I


This protein is a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome.This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IP (-), WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Ribophorin I Antibody (NBP1-69258) (0)

There are no publications for Ribophorin I Antibody (NBP1-69258).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ribophorin I Antibody (NBP1-69258) (0)

There are no reviews for Ribophorin I Antibody (NBP1-69258). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ribophorin I Antibody (NBP1-69258) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Ribophorin I Products

Bioinformatics Tool for Ribophorin I Antibody (NBP1-69258)

Discover related pathways, diseases and genes to Ribophorin I Antibody (NBP1-69258). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ribophorin I Antibody (NBP1-69258)

Discover more about diseases related to Ribophorin I Antibody (NBP1-69258).

Pathways for Ribophorin I Antibody (NBP1-69258)

View related products by pathway.

PTMs for Ribophorin I Antibody (NBP1-69258)

Learn more about PTMs related to Ribophorin I Antibody (NBP1-69258).

Blogs on Ribophorin I

There are no specific blogs for Ribophorin I, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ribophorin I Antibody and receive a gift card or discount.


Gene Symbol RPN1