RhoF Antibody

Images

 
Western Blot: RhoF Antibody [NBP2-32509] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line A-549
Immunohistochemistry: RhoF Antibody [NBP2-32509] - Staining of liver cancer.
Immunohistochemistry: RhoF Antibody [NBP2-32509] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry: RhoF Antibody [NBP2-32509] - Staining of smooth muscle.

Product Details

Summary
Product Discontinued
View other related RhoF Primary Antibodies

Order Details


    • Catalog Number
      NBP2-32509
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RhoF Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KTDLRKDKEQLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFRENVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RhoF Antibody

  • FLJ20247
  • ras homolog gene family, member F (in filopodia)
  • Rho family GTPase Rif
  • Rho in filopodia
  • rho-related GTP-binding protein RhoF
  • RIFARHF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
H00004498-R01
Species: Hu
NB100-1813
Species: Hu
Applications: WB, IP
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-24689
Species: Hu, Mu
Applications: WB
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB110-89459
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RhoF Antibody (NBP2-32509) (0)

There are no publications for RhoF Antibody (NBP2-32509).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoF Antibody (NBP2-32509) (0)

There are no reviews for RhoF Antibody (NBP2-32509). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RhoF Antibody (NBP2-32509) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RhoF Products

Bioinformatics Tool for RhoF Antibody (NBP2-32509)

Discover related pathways, diseases and genes to RhoF Antibody (NBP2-32509). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RhoF Antibody (NBP2-32509)

Discover more about diseases related to RhoF Antibody (NBP2-32509).
 

Pathways for RhoF Antibody (NBP2-32509)

View related products by pathway.

PTMs for RhoF Antibody (NBP2-32509)

Learn more about PTMs related to RhoF Antibody (NBP2-32509).
 

Research Areas for RhoF Antibody (NBP2-32509)

Find related products by research area.

Blogs on RhoF

There are no specific blogs for RhoF, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RhoF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOF