Recombinant Human RHBDD2 Protein

Images

 
SDS-Page: Recombinant Human RHBDD2 Protein [H00057414-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human RHBDD2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-223 of Human RHBDD2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLGVTTVRSRMRRALVFGMVVPSVLVPWLLLGASWLIPQTSFLSNVCGLSIGLAYGLTYCYSIDLSERVALKLDQTFPFSLMRRISVFKYVSGSSAERRAAQSRKLNPVPGSYPTQSCHPHLSPSHPVSQTQHASGQKLASWPSCTPGHMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVPMP

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
RHBDD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
50.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RHBDD2 Protein

  • H_RG122E10.2a
  • H_RG122E10.2b
  • rhomboid domain containing 2
  • rhomboid domain-containing protein 2
  • rhomboid, veinlet-like 7
  • veinlet-like 7 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52105
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-39045
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46000
Species: Hu
Applications: WB, IHC
NBP2-86906
Species: Hu
Applications: WB, IHC, IHC-P
MAB7020
Species: Hu
Applications: WB, IHC
AF4568
Species: Hu, Mu, Rt
Applications: WB, ICC
H00057414-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for RHBDD2 Recombinant Protein (H00057414-P01) (0)

There are no publications for RHBDD2 Recombinant Protein (H00057414-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHBDD2 Recombinant Protein (H00057414-P01) (0)

There are no reviews for RHBDD2 Recombinant Protein (H00057414-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHBDD2 Recombinant Protein (H00057414-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional RHBDD2 Products

Bioinformatics Tool for RHBDD2 Recombinant Protein (H00057414-P01)

Discover related pathways, diseases and genes to RHBDD2 Recombinant Protein (H00057414-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHBDD2 Recombinant Protein (H00057414-P01)

Discover more about diseases related to RHBDD2 Recombinant Protein (H00057414-P01).

Blogs on RHBDD2

There are no specific blogs for RHBDD2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RHBDD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RHBDD2
COVID-19 update