Recombinant Human RGS8 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RGS8 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-80 of Human RGS8

Source: Wheat Germ

Amino Acid Sequence: MWNTLTRSLSDHPVGKDPQAMRTGQRQNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVLLS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RGS8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
34.54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RGS8 Protein

  • MGC119067
  • MGC119068
  • MGC119069
  • regulator of G-protein signaling 8
  • regulator of G-protein signalling 8
  • RGS8

Background

This gene is a member of the regulator of G protein signaling (RGS) family and encodes a protein with a single RGS domain. Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. They accelerate transit through the cycle of GTP binding and hydrolysis to GDP, thereby terminating signal transduction, but paradoxically, also accelerate receptor-stimulated activation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NLS2756
Species: Hu, Mk
Applications: IHC-P, ICC
NLS442
Species: Hu
Applications: IHC-P
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-02393
Species: Hu
Applications: IHC, IHC-P
H00006000-B01P
Species: Hu, Rt
Applications: WB, Flow
NBP2-24945
Species: Hu, Mu, Rt, Po, Ca, Pm
Applications: WB
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58919
Species: Hu
Applications: WB, IHC, IHC-P
H00085397-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for RGS8 Partial Recombinant Protein (H00085397-Q01) (0)

There are no publications for RGS8 Partial Recombinant Protein (H00085397-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS8 Partial Recombinant Protein (H00085397-Q01) (0)

There are no reviews for RGS8 Partial Recombinant Protein (H00085397-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS8 Partial Recombinant Protein (H00085397-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RGS8 Products

Bioinformatics Tool for RGS8 Partial Recombinant Protein (H00085397-Q01)

Discover related pathways, diseases and genes to RGS8 Partial Recombinant Protein (H00085397-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS8 Partial Recombinant Protein (H00085397-Q01)

Discover more about diseases related to RGS8 Partial Recombinant Protein (H00085397-Q01).
 

Pathways for RGS8 Partial Recombinant Protein (H00085397-Q01)

View related products by pathway.

PTMs for RGS8 Partial Recombinant Protein (H00085397-Q01)

Learn more about PTMs related to RGS8 Partial Recombinant Protein (H00085397-Q01).
 

Research Areas for RGS8 Partial Recombinant Protein (H00085397-Q01)

Find related products by research area.

Blogs on RGS8

There are no specific blogs for RGS8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SUCLG1 Antibody
NBP1-89489

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RGS8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS8
Entrez