RGS3 Antibody (1E8-C7) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related RGS3 Primary Antibodies

Order Details


    • Catalog Number
      H00005998-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RGS3 Antibody (1E8-C7) [PE] Summary

Immunogen
RGS3 (AAH18072, 1 a.a. - 192 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLRGMYLTRNGNLQRRHTMKEAKDMKNKLGIFRRRSESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Specificity
RGS3 - regulator of G-protein signalling 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RGS3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RGS3 Antibody (1E8-C7) [PE]

  • C2PA
  • FLJ20370
  • FLJ31516
  • FLJ90496
  • PDZ-RGS3
  • regulator of G-protein signaling 3
  • regulator of G-protein signalling 3
  • RGP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24945
Species: Hu, Mu, Rt, Po, Ca, Pm
Applications: WB
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86020
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00006000-B01P
Species: Hu, Rt
Applications: WB, Flow
NLS418
Species: Hu
Applications: IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu

Publications for RGS3 Antibody (H00005998-M01PE) (0)

There are no publications for RGS3 Antibody (H00005998-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS3 Antibody (H00005998-M01PE) (0)

There are no reviews for RGS3 Antibody (H00005998-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RGS3 Antibody (H00005998-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS3 Products

Bioinformatics Tool for RGS3 Antibody (H00005998-M01PE)

Discover related pathways, diseases and genes to RGS3 Antibody (H00005998-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS3 Antibody (H00005998-M01PE)

Discover more about diseases related to RGS3 Antibody (H00005998-M01PE).
 

Pathways for RGS3 Antibody (H00005998-M01PE)

View related products by pathway.

PTMs for RGS3 Antibody (H00005998-M01PE)

Learn more about PTMs related to RGS3 Antibody (H00005998-M01PE).
 

Research Areas for RGS3 Antibody (H00005998-M01PE)

Find related products by research area.

Blogs on RGS3

There are no specific blogs for RGS3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS3 Antibody (1E8-C7) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS3