RGS20 Antibody (3E10.) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related RGS20 Primary Antibodies

Order Details


    • Catalog Number
      H00008601-M04FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RGS20 Antibody (3E10.) [DyLight 680] Summary

Immunogen
RGS20 (NP_003693 78 a.a. - 176 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS
Specificity
RGS20 - regulator of G-protein signalling 20 (3E10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RGS20
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RGS20 Antibody (3E10.) [DyLight 680]

  • G(z)GAP
  • Gz-GAP
  • Gz-selective GTPase-activating protein
  • regulator of G-protein signaling 20
  • Regulator of G-protein signaling Z1
  • regulator of G-protein signalling 20
  • Regulator of Gz-selective protein signaling 1
  • RGSZ1g(z)GAP
  • ZGAP1gz-GAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24516
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-33694
Species: Hu
Applications: WB, ICC/IF
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88111
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49461
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, In vivo
NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-83257
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86020
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00006000-B01P
Species: Hu, Rt
Applications: WB, Flow
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA

Publications for RGS20 Antibody (H00008601-M04FR) (0)

There are no publications for RGS20 Antibody (H00008601-M04FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS20 Antibody (H00008601-M04FR) (0)

There are no reviews for RGS20 Antibody (H00008601-M04FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RGS20 Antibody (H00008601-M04FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS20 Products

Bioinformatics Tool for RGS20 Antibody (H00008601-M04FR)

Discover related pathways, diseases and genes to RGS20 Antibody (H00008601-M04FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS20 Antibody (H00008601-M04FR)

Discover more about diseases related to RGS20 Antibody (H00008601-M04FR).
 

Pathways for RGS20 Antibody (H00008601-M04FR)

View related products by pathway.

PTMs for RGS20 Antibody (H00008601-M04FR)

Learn more about PTMs related to RGS20 Antibody (H00008601-M04FR).
 

Research Areas for RGS20 Antibody (H00008601-M04FR)

Find related products by research area.

Blogs on RGS20

There are no specific blogs for RGS20, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS20 Antibody (3E10.) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS20