RGL2 Antibody (4D10) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related RGL2 Primary Antibodies

Order Details


    • Catalog Number
      H00005863-M02PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RGL2 Antibody (4D10) [PE] Summary

Immunogen
RGL2 (AAH32681 644 a.a. - 743 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGV
Specificity
RGL2 - ral guanine nucleotide dissociation stimulator-like 2
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
RGL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RGL2 Antibody (4D10) [PE]

  • GDS-related protein
  • HKE1.5
  • KE1.5
  • RAB2, member RAS oncogene family-like
  • RAB2LRas-associated protein RAB2L
  • ral guanine nucleotide dissociation stimulator-like 2
  • RalGDS-like 2
  • RalGDS-like factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023179-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33086
Species: Hu
Applications: WB, ICC/IF
NBP1-81223
Species: Hu
Applications: IHC, IHC-P
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92327
Species: Hu
Applications: WB, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02031
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
H00022800-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005863-M02PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RGL2 Antibody (H00005863-M02PE) (0)

There are no publications for RGL2 Antibody (H00005863-M02PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGL2 Antibody (H00005863-M02PE) (0)

There are no reviews for RGL2 Antibody (H00005863-M02PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RGL2 Antibody (H00005863-M02PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGL2 Products

Bioinformatics Tool for RGL2 Antibody (H00005863-M02PE)

Discover related pathways, diseases and genes to RGL2 Antibody (H00005863-M02PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGL2 Antibody (H00005863-M02PE)

Discover more about diseases related to RGL2 Antibody (H00005863-M02PE).
 

Pathways for RGL2 Antibody (H00005863-M02PE)

View related products by pathway.

PTMs for RGL2 Antibody (H00005863-M02PE)

Learn more about PTMs related to RGL2 Antibody (H00005863-M02PE).
 

Research Areas for RGL2 Antibody (H00005863-M02PE)

Find related products by research area.

Blogs on RGL2

There are no specific blogs for RGL2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGL2 Antibody (4D10) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol RGL2