RFPL3 Antibody

Images

 
Western Blot: RFPL3 Antibody [NBP1-55042] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related RFPL3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-55042
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RFPL3 Antibody Summary

Immunogen
Synthetic peptides corresponding to RFPL3(ret finger protein-like 3) The peptide sequence was selected from the C terminal of RFPL3. Peptide sequence TVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPL.
Predicted Species
Human (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RFPL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RFPL3 and was validated on Western blot.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RFPL3 Antibody

  • ret finger protein-like 3

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57109
Species: Hu
Applications: WB, ICC/IF
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-57626
Species: Hu
Applications: ICC/IF
NBP2-02835
Species: Hu
Applications: WB, Flow, ICC/IF
NB300-750
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20711
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-55042
Species: Hu, Hu
Applications: WB

Publications for RFPL3 Antibody (NBP1-55042) (0)

There are no publications for RFPL3 Antibody (NBP1-55042).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFPL3 Antibody (NBP1-55042) (0)

There are no reviews for RFPL3 Antibody (NBP1-55042). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFPL3 Antibody (NBP1-55042) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RFPL3 Products

Bioinformatics Tool for RFPL3 Antibody (NBP1-55042)

Discover related pathways, diseases and genes to RFPL3 Antibody (NBP1-55042). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFPL3 Antibody (NBP1-55042)

Discover more about diseases related to RFPL3 Antibody (NBP1-55042).
 

Pathways for RFPL3 Antibody (NBP1-55042)

View related products by pathway.

Research Areas for RFPL3 Antibody (NBP1-55042)

Find related products by research area.

Blogs on RFPL3

There are no specific blogs for RFPL3, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFPL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFPL3
Uniprot