RFC3 Antibody

Images

 
Western Blot: RFC3 Antibody [NBP1-58104] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related RFC3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-58104
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RFC3 Antibody Summary

Immunogen
Synthetic peptides corresponding to RFC3(replication factor C (activator 1) 3, 38kDa) The peptide sequence was selected from the C terminal of RFC3. Peptide sequence IIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF.
Specificity
This product is specific to Subunit or Isofrom: 3.
Clonality
Polyclonal
Host
Rabbit
Gene
RFC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RFC3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RFC3 Antibody

  • A1 38 kDa subunit
  • Activator 1 38 kDa subunit
  • Activator 1 subunit 3
  • MGC5276
  • replication factor C (activator 1) 3 (38kD)
  • replication factor C (activator 1) 3, 38kDa
  • Replication factor C 38 kDa subunit
  • replication factor C subunit 3
  • RFC, 38 kD subunit
  • RFC38RF-C 38 kDa subunit

Background

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits. The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. This gene encodes the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56070
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-235
Species: Hu
Applications: WB, PLA
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85525
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
409-ML/CF
Species: Mu
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55454
Species: Hu
Applications: WB, ICC/IF
NBP1-58104
Species: Hu
Applications: WB

Publications for RFC3 Antibody (NBP1-58104) (0)

There are no publications for RFC3 Antibody (NBP1-58104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFC3 Antibody (NBP1-58104) (0)

There are no reviews for RFC3 Antibody (NBP1-58104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFC3 Antibody (NBP1-58104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFC3 Products

Bioinformatics Tool for RFC3 Antibody (NBP1-58104)

Discover related pathways, diseases and genes to RFC3 Antibody (NBP1-58104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFC3 Antibody (NBP1-58104)

Discover more about diseases related to RFC3 Antibody (NBP1-58104).
 

Pathways for RFC3 Antibody (NBP1-58104)

View related products by pathway.

PTMs for RFC3 Antibody (NBP1-58104)

Learn more about PTMs related to RFC3 Antibody (NBP1-58104).
 

Research Areas for RFC3 Antibody (NBP1-58104)

Find related products by research area.

Blogs on RFC3

There are no specific blogs for RFC3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFC3
Uniprot