REV3L Antibody

Images

 

Product Details

Summary
Product Discontinued
View other related REV3L Primary Antibodies

Order Details


    • Catalog Number
      H00005980-A01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

REV3L Antibody Summary

Immunogen
REV3L (NP_002903 2953 a.a. - 3052 a.a.) partial recombinant protein with GST tag. GTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAVILNQEIRELERQQEQLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF
Specificity
REV3L - REV3-like, catalytic subunit of DNA polymerase zeta (yeast)
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
REV3L
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500
Publications
Read Publications using H00005980-A01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for REV3L Antibody

  • EC 2.7.7
  • EC 2.7.7.7
  • hREV3
  • Protein reversionless 3-like
  • REV3 (yeast homolog)-like, catalytic subunit of DNA polymerase zeta
  • REV3-like
  • REV3-like, catalytic subunit of DNA polymerase zeta (yeast)
  • yeast, homolog-like (polymerase, DNA, zeta)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010459-D01P
Species: Hu
Applications: WB, ELISA
NBP2-13219
Species: Hu
Applications: WB, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3417
Species: Hu
Applications: WB
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-58116
Species: Hu
Applications: ICC/IF
H00010721-M09
Species: Hu
Applications: WB, ELISA
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13729
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56360
Species: Hu
Applications: WB
NB100-56320
Species: Hu
Applications: WB
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
H00051426-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA

Publications for REV3L Antibody (H00005980-A01)(3)

Reviews for REV3L Antibody (H00005980-A01) (0)

There are no reviews for REV3L Antibody (H00005980-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REV3L Antibody (H00005980-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional REV3L Products

Bioinformatics Tool for REV3L Antibody (H00005980-A01)

Discover related pathways, diseases and genes to REV3L Antibody (H00005980-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REV3L Antibody (H00005980-A01)

Discover more about diseases related to REV3L Antibody (H00005980-A01).
 

Pathways for REV3L Antibody (H00005980-A01)

View related products by pathway.

PTMs for REV3L Antibody (H00005980-A01)

Learn more about PTMs related to REV3L Antibody (H00005980-A01).
 

Research Areas for REV3L Antibody (H00005980-A01)

Find related products by research area.

Blogs on REV3L

There are no specific blogs for REV3L, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our REV3L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol REV3L
Entrez
OMIM
Uniprot