Retinoblastoma binding protein 1 Antibody (2G8) [PE]

Images

 

Order Details


    • Catalog Number
      H00005926-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Retinoblastoma binding protein 1 Antibody (2G8) [PE] Summary

Immunogen
ARID4A (NP_002883 1033 a.a. - 1139 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AEESQEGLCERESANGFETNVASGTCSIIVQERESREKGQKRPSDGNSGLMAKKQKRTPKRTSAAAKNEKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLAR
Specificity
ARID4A (2G8)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARID4A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Retinoblastoma binding protein 1 Antibody (2G8) [PE]

  • AT rich interactive domain 4A (RBP1-like)
  • RBBP-1
  • RBP-1
  • RBP1ARID domain-containing protein 4A
  • retinoblastoma binding protein 1
  • Retinoblastoma-binding protein 1RBBP1AT-rich interactive domain-containing protein 4A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-16215
Species: Hu
Applications: WB, ChIP, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-80295
Species: Hu
Applications: WB
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF5119
Species: Hu
Applications: WB
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for Retinoblastoma binding protein 1 Antibody (H00005926-M01PE) (0)

There are no publications for Retinoblastoma binding protein 1 Antibody (H00005926-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Retinoblastoma binding protein 1 Antibody (H00005926-M01PE) (0)

There are no reviews for Retinoblastoma binding protein 1 Antibody (H00005926-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Retinoblastoma binding protein 1 Antibody (H00005926-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Retinoblastoma binding protein 1 Products

Bioinformatics Tool for Retinoblastoma binding protein 1 Antibody (H00005926-M01PE)

Discover related pathways, diseases and genes to Retinoblastoma binding protein 1 Antibody (H00005926-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Retinoblastoma binding protein 1 Antibody (H00005926-M01PE)

Discover more about diseases related to Retinoblastoma binding protein 1 Antibody (H00005926-M01PE).
 

Pathways for Retinoblastoma binding protein 1 Antibody (H00005926-M01PE)

View related products by pathway.

PTMs for Retinoblastoma binding protein 1 Antibody (H00005926-M01PE)

Learn more about PTMs related to Retinoblastoma binding protein 1 Antibody (H00005926-M01PE).

Blogs on Retinoblastoma binding protein 1

There are no specific blogs for Retinoblastoma binding protein 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Retinoblastoma binding protein 1 Antibody (2G8) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID4A