Recombinant Human Ret Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Ret Peptides and Proteins

Order Details


    • Catalog Number
      H00005979-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Ret Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 361-458 of Human RET partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIGKVCVENCLADLTGDAVSGRDEARSSGLGSQKHPGS

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
RET

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ret Protein

  • CDHF12MTC1
  • CDHR16
  • EC 2.7.10
  • Hirschsprung disease 1
  • Hirschsprung disease)
  • MEN2A
  • MEN2B
  • multiple endocrine neoplasia and medullary thyroid carcinoma 1
  • ret proto-oncogene
  • RET transforming sequence
  • Ret

Background

RET - ret proto-oncogene (multiple endocrine neoplasia and medullary thyroid carcinoma 1, Hirschsprung disease)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF477
Species: Hu, Mu
Applications: WB, IHC, Block
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1085
Species: Mu
Applications: WB, IHC, Neut
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005979-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Ret Partial Recombinant Protein (H00005979-Q01) (0)

There are no publications for Ret Partial Recombinant Protein (H00005979-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ret Partial Recombinant Protein (H00005979-Q01) (0)

There are no reviews for Ret Partial Recombinant Protein (H00005979-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ret Partial Recombinant Protein (H00005979-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ret Products

Bioinformatics Tool for Ret Partial Recombinant Protein (H00005979-Q01)

Discover related pathways, diseases and genes to Ret Partial Recombinant Protein (H00005979-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ret Partial Recombinant Protein (H00005979-Q01)

Discover more about diseases related to Ret Partial Recombinant Protein (H00005979-Q01).
 

Pathways for Ret Partial Recombinant Protein (H00005979-Q01)

View related products by pathway.

PTMs for Ret Partial Recombinant Protein (H00005979-Q01)

Learn more about PTMs related to Ret Partial Recombinant Protein (H00005979-Q01).
 

Research Areas for Ret Partial Recombinant Protein (H00005979-Q01)

Find related products by research area.

Blogs on Ret.

Beta III tubulin
The Beta III tubulin protein is abundantly present in both the central and peripheral nervous systems (CNS and PNS), where it is predominantly expressed during fetal and postnatal development. In cerebellar and sympathoadrenal neurogenesis, Beta III d...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ret Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RET
Entrez