Ret Antibody (1A5)

Images

 
Sandwich ELISA: Ret Antibody (1A5) [H00005979-M01] - Detection limit for recombinant GST tagged RET is approximately 3ng/ml as a capture antibody.
Proximity Ligation Assay: Ret Antibody (1A5) [H00005979-M01] - Analysis of protein-protein interactions between MAPK3 and RET. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-RET mouse ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
1A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ret Antibody (1A5) Summary

Immunogen
RET (AAH03072 361 a.a. - 458 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIGKVCVENCLADLTGDAVSGRDEARSSGLGSQKHPGS
Specificity
RET - ret proto-oncogene (multiple endocrine neoplasia and medullary thyroid carcinoma 1, Hirschsprung disease)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RET
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ret Antibody (1A5)

  • CDHF12MTC1
  • CDHR16
  • EC 2.7.10
  • Hirschsprung disease 1
  • Hirschsprung disease)
  • MEN2A
  • MEN2B
  • multiple endocrine neoplasia and medullary thyroid carcinoma 1
  • ret proto-oncogene
  • RET transforming sequence
  • Ret

Background

This gene, a member of the cadherin superfamily, encodes one of the receptor tyrosine kinases, which are cell-surface molecules that transduce signals for cell growth and differentiation. This gene plays a crucial role in neural crest development, and it can undergo oncogenic activation in vivo and in vitro by cytogenetic rearrangement. Mutations in this gene are associated with the disorders multiple endocrine neoplasia, type IIA, multiple endocrine neoplasia, type IIB, Hirschsprung disease, and medullary thyroid carcinoma. Two transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their biological validity has not been confirmed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF477
Species: Hu, Mu
Applications: WB, IHC, Block
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1085
Species: Mu
Applications: WB, IHC, Neut
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005979-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for Ret Antibody (H00005979-M01) (0)

There are no publications for Ret Antibody (H00005979-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ret Antibody (H00005979-M01) (0)

There are no reviews for Ret Antibody (H00005979-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ret Antibody (H00005979-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ret Products

Bioinformatics Tool for Ret Antibody (H00005979-M01)

Discover related pathways, diseases and genes to Ret Antibody (H00005979-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ret Antibody (H00005979-M01)

Discover more about diseases related to Ret Antibody (H00005979-M01).
 

Pathways for Ret Antibody (H00005979-M01)

View related products by pathway.

PTMs for Ret Antibody (H00005979-M01)

Learn more about PTMs related to Ret Antibody (H00005979-M01).
 

Research Areas for Ret Antibody (H00005979-M01)

Find related products by research area.

Blogs on Ret.

Beta III tubulin
The Beta III tubulin protein is abundantly present in both the central and peripheral nervous systems (CNS and PNS), where it is predominantly expressed during fetal and postnatal development. In cerebellar and sympathoadrenal neurogenesis, Beta III d...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ret Antibody (1A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol RET
Entrez
OMIM
Uniprot