Recombinant Human Resistin Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Resistin Peptides and Proteins

Order Details


    • Catalog Number
      H00056729-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Resistin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 20-106 of Human RETN partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
RETN

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Resistin Protein

  • Adipose tissue-specific secretory factor
  • ADSF
  • ADSFMGC126609
  • C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich proteinprecursor 1
  • C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein
  • Cysteine-rich secreted protein A12-alpha-like 2
  • Cysteine-rich secreted protein FIZZ3
  • FIZZ3
  • FIZZ3MGC126603
  • found in inflammatory zone 3
  • HXCP1
  • Resistin
  • RETN
  • RETN1
  • RSTNXCP1

Background

This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NB200-204
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB8200
Species: Hu, Mu
Applications: IHC
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00056729-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Resistin Partial Recombinant Protein (H00056729-Q01) (0)

There are no publications for Resistin Partial Recombinant Protein (H00056729-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Resistin Partial Recombinant Protein (H00056729-Q01) (0)

There are no reviews for Resistin Partial Recombinant Protein (H00056729-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Resistin Partial Recombinant Protein (H00056729-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Resistin Products

Bioinformatics Tool for Resistin Partial Recombinant Protein (H00056729-Q01)

Discover related pathways, diseases and genes to Resistin Partial Recombinant Protein (H00056729-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Resistin Partial Recombinant Protein (H00056729-Q01)

Discover more about diseases related to Resistin Partial Recombinant Protein (H00056729-Q01).
 

Pathways for Resistin Partial Recombinant Protein (H00056729-Q01)

View related products by pathway.

PTMs for Resistin Partial Recombinant Protein (H00056729-Q01)

Learn more about PTMs related to Resistin Partial Recombinant Protein (H00056729-Q01).
 

Research Areas for Resistin Partial Recombinant Protein (H00056729-Q01)

Find related products by research area.

Blogs on Resistin.

"Get the skinny" on Adiponectin & Leptin Antibodies
We at Novus Biologicals have an extensive antibody catalog covering lipid and metabolism research, including Adiponectin and leptin antibody products.Excess body fat is linked to many human diseases, including IRS (insulin resistance syndrome), type...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Resistin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RETN
Entrez