RelB Antibody


Western Blot: Rel B Antibody [NBP1-57835] - Transfected 293T cell lysate, concentration 1.25ug/ml.

Product Details

Product Discontinued
View other related RelB Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RelB Antibody Summary

Synthetic peptides corresponding to RELB(v-rel reticuloendotheliosis viral oncogene homolog B) The peptide sequence was selected from the C terminal of RELB. Peptide sequence GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RELB and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RelB Antibody

  • IREL
  • I-Rel
  • nuclear factor of kappalight polypeptide gene enhancer in B-cells 3
  • RelB
  • v-rel reticuloendotheliosis viral oncogene homolog B


RELB neither associates with DNA nor with RELA/p65 or REL. It stimulates promoter activity in the presence of NFKB2/p49.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rb
Applications: WB, Flow, IHC, IHC-P, KO
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for RelB Antibody (NBP1-57835) (0)

There are no publications for RelB Antibody (NBP1-57835).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RelB Antibody (NBP1-57835) (0)

There are no reviews for RelB Antibody (NBP1-57835). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RelB Antibody (NBP1-57835) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RelB Products

Bioinformatics Tool for RelB Antibody (NBP1-57835)

Discover related pathways, diseases and genes to RelB Antibody (NBP1-57835). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RelB Antibody (NBP1-57835)

Discover more about diseases related to RelB Antibody (NBP1-57835).

Pathways for RelB Antibody (NBP1-57835)

View related products by pathway.

PTMs for RelB Antibody (NBP1-57835)

Learn more about PTMs related to RelB Antibody (NBP1-57835).

Blogs on RelB.

NFkB and p62 Both Activate and Regulate Inflammation
Nuclear factor kappa-light-chain-enhancer of activated B cells (NFkB) is a protein complex that regulates DNA transcription and is a critical regulator of cell survival. NFkB has long been known as a primer of inflammation, however researchers are...  Read full blog post.

RelA/NF-kB - A proinflammatory signaling pathway with roles in immunity and cancer
The inflammatory response consists of a complex network of signaling pathways that regulate a diverse set of cytokines, growth factors, adhesion molecules, and transcription factors (1). Of the proinflammatory signaling pathways the NF-kB family is...  Read full blog post.

Recombinant Monoclonal Antibodies

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RelB Antibody and receive a gift card or discount.


Gene Symbol RELB
Novus 100% Guarantee