Recombinant Human Relaxin-1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Relaxin-1 Peptides and Proteins

Order Details


    • Catalog Number
      H00006013-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Relaxin-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 27-185 of Human RLN1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:WKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RLN1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Relaxin-1 Protein

  • bA12D24.3.1
  • bA12D24.3.2
  • H1
  • preprorelaxin H1
  • prorelaxin H1
  • relaxin 1 (H1)
  • relaxin 1
  • relaxin H1
  • Relaxin1
  • Relaxin-1
  • RLN1
  • RLXH1

Background

RLN1( AAH05956, 27 a.a. - 186 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00059350-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
AF3107
Species: Hu
Applications: WB, IHC
AF4817
Species: Mu
Applications: WB
NBP1-32162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81223
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19048
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC

Publications for Relaxin-1 Recombinant Protein (H00006013-P01) (0)

There are no publications for Relaxin-1 Recombinant Protein (H00006013-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Relaxin-1 Recombinant Protein (H00006013-P01) (0)

There are no reviews for Relaxin-1 Recombinant Protein (H00006013-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Relaxin-1 Recombinant Protein (H00006013-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Relaxin-1 Products

Bioinformatics Tool for Relaxin-1 Recombinant Protein (H00006013-P01)

Discover related pathways, diseases and genes to Relaxin-1 Recombinant Protein (H00006013-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Relaxin-1 Recombinant Protein (H00006013-P01)

Discover more about diseases related to Relaxin-1 Recombinant Protein (H00006013-P01).
 

Pathways for Relaxin-1 Recombinant Protein (H00006013-P01)

View related products by pathway.

Blogs on Relaxin-1

There are no specific blogs for Relaxin-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Relaxin-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RLN1
Entrez