Recombinant Human Reg3A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Reg3A Protein Summary

Description
Reg3A (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGW
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
REG3A

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Reg3A Protein

  • hepatocarcinoma-intestine-pancreas
  • HIPpancreatitis-associated protein
  • Human proislet peptide
  • Lithostathine 3
  • pancreatic beta cell growth factor
  • Pancreatitis-associated protein 1
  • PAP homologous protein
  • PAP1FLJ18565
  • PAP2
  • PAPPAP-H
  • PBCGF
  • proliferation-inducing protein 34
  • proliferation-inducing protein 42
  • Reg III-alpha
  • REG3
  • Reg3A
  • REG-3-alpha
  • regenerating islet-derived 3 alpha
  • regenerating islet-derived protein 3-alpha
  • Regenerating islet-derived protein III-alpha
  • REG-III

Background

This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. Multiple alternatively spliced transcript variants encoding the same protein have been described for this gene but the full length nature of some transcripts is not yet known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6240
Species: Hu
Applications: WB, IHC
NBP2-13670
Species: Hu
Applications: WB, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-69571
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-43686
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57650
Species: Hu
Applications: WB
46420002
Species: Hu
Applications: WB, ELISA
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB17861
Species: Hu
Applications: WB, Simple Western
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
AF4478
Species: Hu
Applications: WB, IHC
H00005068-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Reg3A Partial Recombinant Protein (H00005068-Q01) (0)

There are no publications for Reg3A Partial Recombinant Protein (H00005068-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Reg3A Partial Recombinant Protein (H00005068-Q01) (0)

There are no reviews for Reg3A Partial Recombinant Protein (H00005068-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Reg3A Partial Recombinant Protein (H00005068-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human Reg3A Protein Products

Related Products by Gene

Bioinformatics Tool for Reg3A Partial Recombinant Protein (H00005068-Q01)

Discover related pathways, diseases and genes to Reg3A Partial Recombinant Protein (H00005068-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Reg3A Partial Recombinant Protein (H00005068-Q01)

Discover more about diseases related to Reg3A Partial Recombinant Protein (H00005068-Q01).
 

Pathways for Reg3A Partial Recombinant Protein (H00005068-Q01)

View related products by pathway.

PTMs for Reg3A Partial Recombinant Protein (H00005068-Q01)

Learn more about PTMs related to Reg3A Partial Recombinant Protein (H00005068-Q01).

Blogs on Reg3A

There are no specific blogs for Reg3A, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Recombinant Human Reg3A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol REG3A
Entrez
Uniprot

Customers Who Bought This Also Bought

Reg3A Antibody
NBP2-24763
Reg3A Antibody
NBP2-24763