Reg3A Antibody

Images

 
Western Blot: Reg3a Antibody [NBP1-68980] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Reg3A Antibody Summary

Immunogen
Synthetic peptides corresponding to REG3A (regenerating islet-derived 3 alpha) The peptide sequence was selected from the N terminal of REG3A. Peptide sequence GSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
REG3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against REG3A and was validated on Western blot.
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Reg3A Antibody

  • hepatocarcinoma-intestine-pancreas
  • HIPpancreatitis-associated protein
  • Human proislet peptide
  • Lithostathine 3
  • pancreatic beta cell growth factor
  • Pancreatitis-associated protein 1
  • PAP homologous protein
  • PAP1FLJ18565
  • PAP2
  • PAPPAP-H
  • PBCGF
  • proliferation-inducing protein 34
  • proliferation-inducing protein 42
  • Reg III-alpha
  • REG3
  • Reg3A
  • REG-3-alpha
  • regenerating islet-derived 3 alpha
  • regenerating islet-derived protein 3-alpha
  • Regenerating islet-derived protein III-alpha
  • REG-III

Background

This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. Alternate splicing results in multiple transcript variants that encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6240
Species: Hu
Applications: WB, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-43679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP2-46231
Species: Hu
Applications: WB, IHC
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
AF4478
Species: Hu
Applications: WB, IHC
NBP1-68980
Species: Hu
Applications: WB

Publications for Reg3A Antibody (NBP1-68980) (0)

There are no publications for Reg3A Antibody (NBP1-68980).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Reg3A Antibody (NBP1-68980) (0)

There are no reviews for Reg3A Antibody (NBP1-68980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Reg3A Antibody (NBP1-68980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Reg3A Products

Bioinformatics Tool for Reg3A Antibody (NBP1-68980)

Discover related pathways, diseases and genes to Reg3A Antibody (NBP1-68980). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Reg3A Antibody (NBP1-68980)

Discover more about diseases related to Reg3A Antibody (NBP1-68980).
 

Pathways for Reg3A Antibody (NBP1-68980)

View related products by pathway.

PTMs for Reg3A Antibody (NBP1-68980)

Learn more about PTMs related to Reg3A Antibody (NBP1-68980).

Blogs on Reg3A

There are no specific blogs for Reg3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Reg3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol REG3A
Entrez
Uniprot