Recombinant Human Reg1B Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Reg1B Peptides and Proteins

Order Details


    • Catalog Number
      H00005968-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Reg1B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-166 of Human REG1B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
REG1B

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Reg1B Protein

  • Lithostathine 1 beta
  • lithostathine-1-beta
  • Pancreatic stone protein 2
  • pancreatic threadprotein)
  • PSPS2
  • PSPS2PSP-2
  • Reg1B
  • regenerating islet-derived 1 beta
  • Regenerating islet-derived protein 1-beta
  • Regenerating protein I beta
  • REGH
  • REGLREG-1-beta
  • secretory pancreatic stone protein 2

Background

REG1B( AAH27895, 1 a.a. - 167 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4937
Species: Hu
Applications: WB, IHC
AF1657
Species: Mu
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
AF5659
Species: Hu
Applications: WB
NBP1-56848
Species: Hu
Applications: WB
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
MAB2388
Species: Hu
Applications: WB, IHC

Publications for Reg1B Recombinant Protein (H00005968-P01) (0)

There are no publications for Reg1B Recombinant Protein (H00005968-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Reg1B Recombinant Protein (H00005968-P01) (0)

There are no reviews for Reg1B Recombinant Protein (H00005968-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Reg1B Recombinant Protein (H00005968-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Reg1B Products

Bioinformatics Tool for Reg1B Recombinant Protein (H00005968-P01)

Discover related pathways, diseases and genes to Reg1B Recombinant Protein (H00005968-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Reg1B Recombinant Protein (H00005968-P01)

Discover more about diseases related to Reg1B Recombinant Protein (H00005968-P01).
 

Pathways for Reg1B Recombinant Protein (H00005968-P01)

View related products by pathway.

PTMs for Reg1B Recombinant Protein (H00005968-P01)

Learn more about PTMs related to Reg1B Recombinant Protein (H00005968-P01).

Blogs on Reg1B

There are no specific blogs for Reg1B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Reg1B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol REG1B
Entrez