Recombinant Human Reg1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Reg1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 23-122 of Human REG1A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
REG1A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Reg1 Protein

  • ICRF
  • Islet cells regeneration factor
  • Islet of Langerhans regenerating protein
  • lithostathine-1-alpha
  • Pancreatic stone protein
  • pancreatic stone protein, secretory
  • Pancreatic thread protein
  • protein-X
  • PSPregenerating islet-derived 1 alpha (pancreatic stone protein, pancreatic threadprotein)
  • PSPS1REG-1-alpha
  • PSPSMGC12447
  • PTPP19
  • Reg1
  • regenerating islet-derived 1 alpha
  • Regenerating islet-derived protein 1-alpha
  • Regenerating protein I alpha
  • REGlithostathine 1 alpha

Background

This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1366
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF

Publications for Reg1 Partial Recombinant Protein (H00005967-Q02) (0)

There are no publications for Reg1 Partial Recombinant Protein (H00005967-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Reg1 Partial Recombinant Protein (H00005967-Q02) (0)

There are no reviews for Reg1 Partial Recombinant Protein (H00005967-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Reg1 Partial Recombinant Protein (H00005967-Q02). (Showing 1 - 2 of 2 FAQ).

  1. I want to set up ELISA for the detection of human Reg1 protein in serum and stool samples. Can you provide me the information of appropriate standards and pairs of antibodies to be used in ELISA?
    • A list of our paired antibodies for use in ELISA for Reg1 can be found at the following link: Reg1 paired antibodies. For these pairs, H00005967-Q01 should be used as a standard.
  2. I would like to know how many tests can be done from these antibodies?
    • These pairs are produced by a Taiwanese company called Abnova and we distribute for them. We do no in-house testing or development of their products. As is clearly listed on our datasheet, all of these antibody pairs utilize a biotinylated secondary antibody, so all are suitable for use with avidin peroxidase. It also states that Reagents are sufficient for at least 3-5 x 96 well plates using recommended protocols. Please see Abnova's recommended protocol.

Additional Reg1 Products

Bioinformatics Tool for Reg1 Partial Recombinant Protein (H00005967-Q02)

Discover related pathways, diseases and genes to Reg1 Partial Recombinant Protein (H00005967-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Reg1 Partial Recombinant Protein (H00005967-Q02)

Discover more about diseases related to Reg1 Partial Recombinant Protein (H00005967-Q02).
 

Pathways for Reg1 Partial Recombinant Protein (H00005967-Q02)

View related products by pathway.

PTMs for Reg1 Partial Recombinant Protein (H00005967-Q02)

Learn more about PTMs related to Reg1 Partial Recombinant Protein (H00005967-Q02).
 

Research Areas for Reg1 Partial Recombinant Protein (H00005967-Q02)

Find related products by research area.

Blogs on Reg1

There are no specific blogs for Reg1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Reg1 Antibody
NBP2-13215

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Reg1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol REG1A
Entrez