Reg1 Antibody


Immunohistochemistry-Paraffin: Reg1 Antibody [NBP2-13216] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Reg1 Antibody [NBP2-13216] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells with distinct extracellular material.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Reg1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWG
Specificity of human Reg1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Reg1 Protein (NBP2-13216PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Reg1 Antibody

  • ICRF
  • Islet cells regeneration factor
  • Islet of Langerhans regenerating protein
  • lithostathine-1-alpha
  • Pancreatic stone protein
  • pancreatic stone protein, secretory
  • Pancreatic thread protein
  • protein-X
  • PSPregenerating islet-derived 1 alpha (pancreatic stone protein, pancreatic threadprotein)
  • PSPS1REG-1-alpha
  • PSPSMGC12447
  • PTPP19
  • Reg1
  • regenerating islet-derived 1 alpha
  • Regenerating islet-derived protein 1-alpha
  • Regenerating protein I alpha
  • REGlithostathine 1 alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC
Species: Hu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Reg1 Antibody (NBP2-13216) (0)

There are no publications for Reg1 Antibody (NBP2-13216).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Reg1 Antibody (NBP2-13216) (0)

There are no reviews for Reg1 Antibody (NBP2-13216). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Reg1 Antibody (NBP2-13216) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Reg1 Products

Bioinformatics Tool for Reg1 Antibody (NBP2-13216)

Discover related pathways, diseases and genes to Reg1 Antibody (NBP2-13216). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Reg1 Antibody (NBP2-13216)

Discover more about diseases related to Reg1 Antibody (NBP2-13216).

Pathways for Reg1 Antibody (NBP2-13216)

View related products by pathway.

PTMs for Reg1 Antibody (NBP2-13216)

Learn more about PTMs related to Reg1 Antibody (NBP2-13216).

Research Areas for Reg1 Antibody (NBP2-13216)

Find related products by research area.

Blogs on Reg1

There are no specific blogs for Reg1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Reg1 Antibody and receive a gift card or discount.


Gene Symbol REG1A