RED2 Antibody

Images

 
Immunohistochemistry-Paraffin: RED2 Antibody [NBP1-90238] Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related RED2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-90238
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RED2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ARRTPMPQEFADSISQLVTQKFREVTTDLTPMHARHKALAGIVMTKGLDARQAQVVALSSGTKCIS
Specificity
Specificity of human RED2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADARB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-90238 in the following applications:

Publications
Read Publication using NBP1-90238.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24139042)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RED2 Antibody

  • ADAR3adenosine deaminase, RNA-specific, B2 (RED1 homolog rat)
  • adenosine deaminase, RNA-specific, B2 (RED2 homolog rat)
  • adenosine deaminase, RNA-specific, B2
  • double-stranded RNA-specific editase B2
  • dsRNA adenosine deaminase B2
  • EC 3.5
  • EC 3.5.1.2
  • EC 3.5.4
  • FLJ25034
  • homolog of rat BLUE
  • hRED2
  • RED2 homolog
  • RED2FLJ36975
  • RNA-dependent adenosine deaminase 3
  • RNA-editing deaminase 2
  • RNA-editing enzyme 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66402
Species: Hu
H00000104-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93325
Species: Hu
Applications: WB, IP
NBP2-24940
Species: Hu, Ye
Applications: WB
NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-49106
Species: Hu
Applications: WB, IHC, IHC-P
NB100-40853
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF3297
Species: Hu
Applications: WB
AF4237
Species: Mu
Applications: WB, IHC
H00001646-M03
Species: Hu
Applications: WB, ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5480
Species: Hu
Applications: IHC
H00003836-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-50163
Species: Hu, Mu
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready
NBP1-76786
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-03061
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77939
Species: Hu, Mu, Rt, Ca, Ch, Pm, Ze
Applications: WB, ELISA

Publications for RED2 Antibody (NBP1-90238)(1)

Review for RED2 Antibody (NBP1-90238) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-90238:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen RED2 NBP1-90238
Enlarge
reviewed by:
Anonymous
IHC-Fr Mouse 12/08/2017
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedAdult spinal cord
SpeciesMouse
LotA95452

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RED2 Antibody (NBP1-90238) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RED2 Products

Bioinformatics Tool for RED2 Antibody (NBP1-90238)

Discover related pathways, diseases and genes to RED2 Antibody (NBP1-90238). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RED2 Antibody (NBP1-90238)

Discover more about diseases related to RED2 Antibody (NBP1-90238).
 

Pathways for RED2 Antibody (NBP1-90238)

View related products by pathway.

Blogs on RED2

There are no specific blogs for RED2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
12/08/2017
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol ADARB2