RED1 Antibody


Western Blot: RED1 Antibody [NBP1-57353] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related RED1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RED1 Antibody Summary

Synthetic peptides corresponding to ADARB1(adenosine deaminase, RNA-specific, B1 (RED1 homolog rat)) The peptide sequence was selected from the N terminal of ADARB1. Peptide sequence NMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ADARB1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RED1 Antibody

  • ADAR2a
  • ADAR2a-L1
  • ADAR2a-L2
  • ADAR2a-L3
  • ADAR2b
  • ADAR2c
  • adenosine deaminase, RNA-specific, B1
  • double-stranded RNA-specific editase 1
  • DRABA2
  • EC 3.5
  • human dsRNA adenosine deaminase DRADA2
  • human dsRNA adenosine deaminase DRADA2b, EC 3.510adenosine deaminase, RNA-specific, B1 (homolog of rat RED1)
  • RED1 homolog
  • RED1ADAR2d
  • RNA editase
  • RNA editing deaminase 1
  • RNA-editing deaminase 1
  • RNA-editing enzyme 1
  • RNA-specific, B1 (RED1 homolog rat)


ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, B/N
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, In vivo
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD

Publications for RED1 Antibody (NBP1-57353) (0)

There are no publications for RED1 Antibody (NBP1-57353).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RED1 Antibody (NBP1-57353) (0)

There are no reviews for RED1 Antibody (NBP1-57353). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RED1 Antibody (NBP1-57353) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RED1 Products

Bioinformatics Tool for RED1 Antibody (NBP1-57353)

Discover related pathways, diseases and genes to RED1 Antibody (NBP1-57353). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RED1 Antibody (NBP1-57353)

Discover more about diseases related to RED1 Antibody (NBP1-57353).

Pathways for RED1 Antibody (NBP1-57353)

View related products by pathway.

Blogs on RED1

There are no specific blogs for RED1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RED1 Antibody and receive a gift card or discount.


Gene Symbol ADARB1