RECQL5 Antibody

Images

 

Product Details

Summary
Product Discontinued
View other related RECQL5 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69712
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RECQL5 Antibody Summary

Immunogen
Synthetic peptides corresponding to RECQL5(RecQ protein-like 5) The peptide sequence was selected from the middle region of RECQL5. Peptide sequence CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD.
Clonality
Polyclonal
Host
Rabbit
Gene
RECQL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RECQL5 and was validated on Western blot.
Theoretical MW
109 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RECQL5 Antibody

  • DNA helicase, RecQ-like type 5
  • EC 3.6.1
  • EC 3.6.4.12
  • FLJ90603
  • RecQ protein-like 5ATP-dependent DNA helicase Q5
  • RecQ5
  • RECQ5RecQ protein 5

Background

RECQL5 may have an important role in DNA metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NB100-619
Species: Hu
Applications: WB, IHC, IHC-P, IP
25470002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-16338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-22360
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33169
Species: Hu, Mu
Applications: WB
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1726
Species: Hu
Applications: WB, IHC, ICC
NBP1-69712
Species: Hu
Applications: WB

Publications for RECQL5 Antibody (NBP1-69712) (0)

There are no publications for RECQL5 Antibody (NBP1-69712).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RECQL5 Antibody (NBP1-69712) (0)

There are no reviews for RECQL5 Antibody (NBP1-69712). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RECQL5 Antibody (NBP1-69712) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RECQL5 Products

Bioinformatics Tool for RECQL5 Antibody (NBP1-69712)

Discover related pathways, diseases and genes to RECQL5 Antibody (NBP1-69712). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RECQL5 Antibody (NBP1-69712)

Discover more about diseases related to RECQL5 Antibody (NBP1-69712).
 

Pathways for RECQL5 Antibody (NBP1-69712)

View related products by pathway.

PTMs for RECQL5 Antibody (NBP1-69712)

Learn more about PTMs related to RECQL5 Antibody (NBP1-69712).

Blogs on RECQL5

There are no specific blogs for RECQL5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RECQL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RECQL5
Uniprot