Recoverin Antibody (5A6)

Images

 
Sandwich ELISA: Recoverin Antibody (5A6) [H00005957-M04] - Detection limit for recombinant GST tagged RCV1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related Recoverin Primary Antibodies

Order Details


    • Catalog Number
      H00005957-M04
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recoverin Antibody (5A6) Summary

Immunogen
RCV1 (NP_002894.1, 101 a.a. - 199 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKN
Specificity
RCV1 (5A6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RCVRN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recoverin Antibody (5A6)

  • cancer associated retinopathy antigen
  • Protein CAR
  • RCV1Cancer-associated retinopathy protein
  • recoverin

Background

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003208-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-2776
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
H00002978-R01V
Species: Hu
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00005957-M04
Species: Hu
Applications: WB, ELISA

Publications for Recoverin Antibody (H00005957-M04) (0)

There are no publications for Recoverin Antibody (H00005957-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Recoverin Antibody (H00005957-M04) (0)

There are no reviews for Recoverin Antibody (H00005957-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Recoverin Antibody (H00005957-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Recoverin Products

Bioinformatics Tool for Recoverin Antibody (H00005957-M04)

Discover related pathways, diseases and genes to Recoverin Antibody (H00005957-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Recoverin Antibody (H00005957-M04)

Discover more about diseases related to Recoverin Antibody (H00005957-M04).
 

Pathways for Recoverin Antibody (H00005957-M04)

View related products by pathway.

PTMs for Recoverin Antibody (H00005957-M04)

Learn more about PTMs related to Recoverin Antibody (H00005957-M04).
 

Research Areas for Recoverin Antibody (H00005957-M04)

Find related products by research area.

Blogs on Recoverin

There are no specific blogs for Recoverin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recoverin Antibody (5A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol RCVRN
Entrez
OMIM
Uniprot