Recombinant Human RCBTB1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RCBTB1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2 - 90 of Human RCBTB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEGLCGKKIKSLSYGSGPHVLLS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RCBTB1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RCBTB1 Protein

  • Chronic lymphocytic leukemia deletion region gene 7 protein
  • CLL deletion region gene 7 protein
  • CLLD7MGC33184
  • CLLL7
  • E4.5
  • FLJ10716
  • GDP/GTP exchange factor (GEF)-like protein
  • GLP
  • RCC1 and BTB domain-containing protein 1
  • regulator of chromosome condensation (RCC1) and BTB (POZ) domain containingprotein 1
  • Regulator of chromosome condensation and BTB domain-containing protein 1
  • RP11-185C18.1

Background

This gene encodes a protein with an N-terminal RCC1 domain and a C-terminal BTB (broad complex, tramtrack and bric-a-brac) domain. In rat, over-expression of this gene in vascular smooth muscle cells induced cellular hypertrophy. In rat, the C-terminus of RCBTB1 interacts with the angiotensin II receptor-1A. In humans, this gene maps to a region of chromosome 13q that is frequently deleted in B-cell chronic lymphocytic leukemia and other lymphoid malignancies. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB8864
Species: Hu
Applications: IHC
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-89771
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3145
Species: Hu
Applications: WB
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-91679
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RCBTB1 Partial Recombinant Protein (H00055213-Q01) (0)

There are no publications for RCBTB1 Partial Recombinant Protein (H00055213-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCBTB1 Partial Recombinant Protein (H00055213-Q01) (0)

There are no reviews for RCBTB1 Partial Recombinant Protein (H00055213-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RCBTB1 Partial Recombinant Protein (H00055213-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RCBTB1 Products

Bioinformatics Tool for RCBTB1 Partial Recombinant Protein (H00055213-Q01)

Discover related pathways, diseases and genes to RCBTB1 Partial Recombinant Protein (H00055213-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCBTB1 Partial Recombinant Protein (H00055213-Q01)

Discover more about diseases related to RCBTB1 Partial Recombinant Protein (H00055213-Q01).
 

Pathways for RCBTB1 Partial Recombinant Protein (H00055213-Q01)

View related products by pathway.

Blogs on RCBTB1

There are no specific blogs for RCBTB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RCBTB1 Antibody
NBP2-20116
GLP-1R Antibody
NBP1-97308

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RCBTB1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RCBTB1