RCAN1 Antibody (1B1) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related RCAN1 Primary Antibodies

Order Details


    • Catalog Number
      H00001827-M03G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RCAN1 Antibody (1B1) [DyLight 488] Summary

Immunogen
DSCR1 (AAH02864, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPN
Specificity
DSCR1 (1B1)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RCAN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RCAN1 Antibody (1B1) [DyLight 488]

  • ADAPT78
  • calcipressin-1
  • calcium and oxidant-inducible mRNA
  • Down syndrome candidate region 1
  • Down syndrome critical region gene 1
  • Down syndrome critical region protein 1
  • DSC1
  • modulatory calcineurin-interacting protein 1
  • Myocyte-enriched calcineurin-interacting protein 1
  • near DSCR proline-rich protein
  • regulator of calcineurin 1CSP1DSCR1MCIP1RCN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76995
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7265
Species: Mu
Applications: WB, IHC
MAB944
Species: Hu
Applications: WB, IHC
AF7490
Species: Mu
Applications: IHC
NBP1-91745
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84972
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56732
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00001859-M01
Species: Hu
Applications: WB, ELISA, IHC, IP
NBP1-78984
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
H00001827-M03G
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RCAN1 Antibody (H00001827-M03G) (0)

There are no publications for RCAN1 Antibody (H00001827-M03G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCAN1 Antibody (H00001827-M03G) (0)

There are no reviews for RCAN1 Antibody (H00001827-M03G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RCAN1 Antibody (H00001827-M03G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RCAN1 Products

Bioinformatics Tool for RCAN1 Antibody (H00001827-M03G)

Discover related pathways, diseases and genes to RCAN1 Antibody (H00001827-M03G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCAN1 Antibody (H00001827-M03G)

Discover more about diseases related to RCAN1 Antibody (H00001827-M03G).
 

Pathways for RCAN1 Antibody (H00001827-M03G)

View related products by pathway.

PTMs for RCAN1 Antibody (H00001827-M03G)

Learn more about PTMs related to RCAN1 Antibody (H00001827-M03G).
 

Research Areas for RCAN1 Antibody (H00001827-M03G)

Find related products by research area.

Blogs on RCAN1

There are no specific blogs for RCAN1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCAN1 Antibody (1B1) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol RCAN1