RBP4/Retinol-Binding Protein 4 Antibody


Western Blot: RBP4/Retinol-Binding Protein 4 Antibody [NBP1-58025] - Human Stomach, concentration 0.2-1 ug/ml.
Immunohistochemistry: RBP4/Retinol-Binding Protein 4 Antibody [NBP1-58025] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in Kupffer cells and sinusoids Primary Antibody ...read more

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RBP4/Retinol-Binding Protein 4 Antibody Summary

Synthetic peptides corresponding to RBP4(retinol binding protein 4, plasma) The peptide sequence was selected from the N terminal of RBP4. Peptide sequence MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against RBP4 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RBP4/Retinol-Binding Protein 4 Antibody

  • interstitial
  • Plasma retinol-binding protein
  • RBP4
  • retinol binding protein 4, plasma
  • RetinolBinding Protein 4
  • retinol-binding protein 4, plasma


This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin whi


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu

Publications for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025) (0)

There are no publications for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025) (0)

There are no reviews for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RBP4/Retinol-Binding Protein 4 Antibody Products

Related Products by Gene

Bioinformatics Tool for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025)

Discover related pathways, diseases and genes to RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025)

Discover more about diseases related to RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025).

Pathways for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025)

View related products by pathway.

PTMs for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025)

Learn more about PTMs related to RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025).

Research Areas for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025)

Find related products by research area.

Blogs on RBP4/Retinol-Binding Protein 4

There are no specific blogs for RBP4/Retinol-Binding Protein 4, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RBP4/Retinol-Binding Protein 4 Antibody and receive a gift card or discount.


Gene Symbol RBP4