RBP4/Retinol-Binding Protein 4 Antibody

Images

 
Western Blot: RBP4/Retinol-Binding Protein 4 Antibody [NBP1-58025] - Human Stomach, concentration 0.2-1 ug/ml.
Immunohistochemistry: RBP4/Retinol-Binding Protein 4 Antibody [NBP1-58025] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in Kupffer cells and sinusoids Primary Antibody ...read more

Order Details


    • Catalog Number
      NBP1-58025
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RBP4/Retinol-Binding Protein 4 Antibody Summary

Immunogen
Synthetic peptides corresponding to RBP4(retinol binding protein 4, plasma) The peptide sequence was selected from the N terminal of RBP4. Peptide sequence MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP.
Clonality
Polyclonal
Host
Rabbit
Gene
RBP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against RBP4 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RBP4/Retinol-Binding Protein 4 Antibody

  • interstitial
  • Plasma retinol-binding protein
  • RBP4/Retinol-Binding Protein 4
  • retinol binding protein 4, plasma
  • RetinolBinding Protein 4
  • retinol-binding protein 4, plasma

Background

This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin whi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7505
Species: Hu
Applications: WB, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-594
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82601
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-81029
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
H00005555-P01
Species: Hu

Publications for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025) (0)

There are no publications for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025) (0)

There are no reviews for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBP4/Retinol-Binding Protein 4 Antibody Products

Related Products by Gene

Bioinformatics Tool for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025)

Discover related pathways, diseases and genes to RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025)

Discover more about diseases related to RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025).
 

Pathways for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025)

View related products by pathway.

PTMs for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025)

Learn more about PTMs related to RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025).
 

Research Areas for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-58025)

Find related products by research area.

Blogs on RBP4/Retinol-Binding Protein 4

There are no specific blogs for RBP4/Retinol-Binding Protein 4, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RBP4
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-58025 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.