RBP4/Retinol-Binding Protein 4 Antibody (4B10)

Images

 
ELISA: RBP4/Retinol-Binding Protein 4 Antibody (4B10) [H00005950-M09] - Detection limit for recombinant GST tagged RBP4 is approximately 0.3ng/ml as a capture antibody.

Order Details


    • Catalog Number
      H00005950-M09
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RBP4/Retinol-Binding Protein 4 Antibody (4B10) Summary

Immunogen
RBP4 (NP_006735.2, 103 a.a. - 201 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Specificity
RBP4 - retinol binding protein 4, plasma (4B10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RBP4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RBP4/Retinol-Binding Protein 4 Antibody (4B10)

  • interstitial
  • Plasma retinol-binding protein
  • RBP4
  • retinol binding protein 4, plasma
  • RetinolBinding Protein 4
  • retinol-binding protein 4, plasma

Background

This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-81029
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-07799
Species: Hu
H00005950-M09
Species: Hu
Applications: ELISA

Publications for RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09) (0)

There are no publications for RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09) (0)

There are no reviews for RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBP4/Retinol-Binding Protein 4 Products

Bioinformatics Tool for RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09)

Discover related pathways, diseases and genes to RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09)

Discover more about diseases related to RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09).
 

Pathways for RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09)

View related products by pathway.

PTMs for RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09)

Learn more about PTMs related to RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09).
 

Research Areas for RBP4/Retinol-Binding Protein 4 Antibody (H00005950-M09)

Find related products by research area.

Blogs on RBP4/Retinol-Binding Protein 4

There are no specific blogs for RBP4/Retinol-Binding Protein 4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBP4/Retinol-Binding Protein 4 Antibody (4B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol RBP4
Entrez
Uniprot