Recombinant Human RBM6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RBM6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1024-1123 of Human RBM6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RBM6
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RBM6 Protein

  • DEF-3
  • DEF3FLJ39446,3G2
  • DKFZp686B0877
  • FLJ36517
  • FLJ42036
  • g16
  • HLC-11
  • Lung cancer antigen NY-LU-12
  • lung cancer protooncogene 11
  • NY-LU-12
  • Protein G16
  • RNA binding motif protein 6
  • RNA-binding motif protein 6
  • RNA-binding protein 6
  • RNA-binding protein DEF-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33955
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57898
Species: Hu
Applications: WB, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
H00009374-T01
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-33480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89810
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-21065
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RBM6 Partial Recombinant Protein (H00010180-Q01) (0)

There are no publications for RBM6 Partial Recombinant Protein (H00010180-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM6 Partial Recombinant Protein (H00010180-Q01) (0)

There are no reviews for RBM6 Partial Recombinant Protein (H00010180-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBM6 Partial Recombinant Protein (H00010180-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBM6 Products

Bioinformatics Tool for RBM6 Partial Recombinant Protein (H00010180-Q01)

Discover related pathways, diseases and genes to RBM6 Partial Recombinant Protein (H00010180-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM6 Partial Recombinant Protein (H00010180-Q01)

Discover more about diseases related to RBM6 Partial Recombinant Protein (H00010180-Q01).
 

Pathways for RBM6 Partial Recombinant Protein (H00010180-Q01)

View related products by pathway.

PTMs for RBM6 Partial Recombinant Protein (H00010180-Q01)

Learn more about PTMs related to RBM6 Partial Recombinant Protein (H00010180-Q01).

Blogs on RBM6

There are no specific blogs for RBM6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RBM6 Antibody
NBP1-89376

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RBM6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM6