RBFOX3/NeuN Antibody


Immunocytochemistry/ Immunofluorescence: RBFOX3/NeuN Antibody [NBP1-89821] - Staining of human cell line A549 shows localization to nucleoplasm. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RBFOX3/NeuN Antibody [NBP1-89821] - Staining in human cerebral cortex and pancreas tissues using anti-RBFOX3 antibody. Corresponding RBFOX3 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: RBFOX3/NeuN Antibody [NBP1-89821] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: RBFOX3/NeuN Antibody [NBP1-89821] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

RBFOX3/NeuN Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQ
Neuronal Marker
Specificity of human RBFOX3/NeuN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBFOX3/NeuN Recombinant Protein Antigen (NBP1-89821PEP)
Read Publications using NBP1-89821.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24747576)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RBFOX3/NeuN Antibody

  • FLJ56884
  • FLJ58356
  • Fox-1 homolog C
  • FOX3
  • FOX-3
  • hexaribonucleotide binding protein 3
  • HRNBP3
  • NeuN
  • neuronal nuclei
  • RBFOX3
  • RNA binding protein fox-1 homolog 3
  • RNA binding protein, fox-1 homolog (C. elegans) 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Ch, Fe, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for RBFOX3/NeuN Antibody (NBP1-89821)(2)

Reviews for RBFOX3/NeuN Antibody (NBP1-89821) (0)

There are no reviews for RBFOX3/NeuN Antibody (NBP1-89821). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RBFOX3/NeuN Antibody (NBP1-89821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RBFOX3/NeuN Antibody (NBP1-89821)

Discover related pathways, diseases and genes to RBFOX3/NeuN Antibody (NBP1-89821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBFOX3/NeuN Antibody (NBP1-89821)

Discover more about diseases related to RBFOX3/NeuN Antibody (NBP1-89821).

Pathways for RBFOX3/NeuN Antibody (NBP1-89821)

View related products by pathway.

Research Areas for RBFOX3/NeuN Antibody (NBP1-89821)

Find related products by research area.

Blogs on RBFOX3/NeuN.

RBFOX3: Binding RNA, like a FOX
NeuN is a RNA-binding protein that modulates alternative splicing and is localized both to the nucleus and cytoplasm. It is a member of the RNA-binding FOX (RBFOX) family of splicing regulators which includes RBFOX1 (Fox-1/A2BP1) and RBFOX2 (Fox-2/RBM...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RBFOX3/NeuN Antibody and receive a gift card or discount.


Gene Symbol RBFOX3